Western Blot (WB)
(Archain 1 antibody (MBS5302353) used at 1 ug/ml to detect target protein.)
Rabbit Archain 1 Polyclonal Antibody | anti-arcn1 antibody
Archain 1 antibody
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
Archain 1; Polyclonal Antibody; Archain 1 antibody; Polyclonal Archain 1; Anti-Archain 1; ARCH1; COPD; anti-arcn1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
Archain 1 antibody was raised against the middle region of ARCN1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARCN1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
513
Applicable Applications for anti-arcn1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The gene that encodes ARCN1 maps in a region, which includes the mixed lineage leukemia and Friend leukemia virus integration 1 genes, where multiple disease-associated chromosome translocations occur. ARCN1 is an intracellular protein. Archain sequences are well conserved among eukaryotes and this protein may play a fundamental role in eukaryotic cell biology. It has similarities to heat shock proteins and clathrin-associated proteins, and may be involved in vesicle structure or trafficking.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
Archain 1 antibody was raised using the middle region of ARCN1 corresponding to a region with amino acids GGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFT
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(Archain 1 antibody (MBS5302353) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(Archain 1 antibody (MBS5302353) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-arcn1 antibody
Rabbit polyclonal Archain 1 antibody raised against the middle region of ARCN1
Product Categories/Family for anti-arcn1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
57 kDa (MW of target protein)
NCBI Official Full Name
archain 1
NCBI Official Synonym Full Names
archain 1<
NCBI Official Symbol
arcn1
NCBI Protein Information
archain 1
Protein Family
Similar Products
Product Notes
The arcn1 (Catalog #AAA5302353) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Archain 1 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Archain 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the arcn1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Archain 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
