Western Blot (WB)
(TUSC1 antibody (MBS5300530) used at 1 ug/ml to detect target protein.)
Rabbit anti-Human, Rat TUSC1 Polyclonal Antibody | anti-TUSC1 antibody
TUSC1 antibody
Gene Names
TUSC1; TSG9; TSG-9
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
TUSC1; Polyclonal Antibody; TUSC1 antibody; Polyclonal TUSC1; Anti-TUSC1; TSG9; MGC131751; TUSC-1; TUSC 1; Tumor Suppressor Candidate 1; TSG-9; anti-TUSC1 antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Specificity
TUSC1 antibody was raised against the middle region of TUSC1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TUSC1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
212
Applicable Applications for anti-TUSC1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Tusc1 gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis.
Cross-Reactivity
Human,Rat
Immunogen
TUSC1 antibody was raised using the middle region of TUSC1 corresponding to a region with amino acids DSGREDEPGSPRALRARLEKLEAMYRRALLQLHLEQRGPRPSGDKEEQPL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(TUSC1 antibody (MBS5300530) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(TUSC1 antibody (MBS5300530) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-TUSC1 antibody
Rabbit polyclonal TUSC1 antibody raised against the middle region of TUSC1
Product Categories/Family for anti-TUSC1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23 kDa (MW of target protein)
NCBI Official Full Name
tumor suppressor candidate gene 1 protein
NCBI Official Synonym Full Names
tumor suppressor candidate 1
NCBI Official Symbol
TUSC1
NCBI Official Synonym Symbols
TSG9; TSG-9
NCBI Protein Information
tumor suppressor candidate gene 1 protein
UniProt Protein Name
Tumor suppressor candidate gene 1 protein
Protein Family
UniProt Gene Name
TUSC1
UniProt Synonym Gene Names
TSG9
UniProt Entry Name
TUSC1_HUMAN
NCBI Description
This gene is located within the region of chromosome 9p that harbors tumor suppressor genes critical in carcinogenesis. It is an intronless gene which is downregulated in non-small-cell lung cancer and small-cell lung cancer cell lines, suggesting that it may play a role in lung tumorigenesis. [provided by RefSeq, Jul 2008]
Uniprot Description
TUSC1:
Chromosomal Location of Human Ortholog: 9p21.2
Research Articles on TUSC1
Similar Products
Product Notes
The TUSC1 tusc1 (Catalog #AAA5300530) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TUSC1 antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TUSC1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the TUSC1 tusc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TUSC1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
