Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: AQP5Sample Type: COLO205 Whole cell lysatesAntibody Dilution: 1.0ug/mlAQP5 is supported by BioGPS gene expression data to be expressed in COLO205)

Rabbit AQP5 Polyclonal Antibody | anti-AQP5 antibody

AQP5 Antibody - C-terminal region

Gene Names
AQP5; PPKB; AQP-5
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AQP5; Polyclonal Antibody; AQP5 Antibody - C-terminal region; anti-AQP5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDE
Sequence Length
265
Applicable Applications for anti-AQP5 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Rat: 86%; Sheep: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human AQP5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AQP5Sample Type: COLO205 Whole cell lysatesAntibody Dilution: 1.0ug/mlAQP5 is supported by BioGPS gene expression data to be expressed in COLO205)

Western Blot (WB) (Host: RabbitTarget Name: AQP5Sample Type: COLO205 Whole cell lysatesAntibody Dilution: 1.0ug/mlAQP5 is supported by BioGPS gene expression data to be expressed in COLO205)
Related Product Information for anti-AQP5 antibody
This is a rabbit polyclonal antibody against AQP5. It was validated on Western Blot

Target Description: Aquaporin 5 (AQP5) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions. AQP0, AQP2, AQP5, and AQP6 are closely related and all map to 12q13.
Product Categories/Family for anti-AQP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
362
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28kDa
NCBI Official Full Name
aquaporin-5
NCBI Official Synonym Full Names
aquaporin 5
NCBI Official Symbol
AQP5
NCBI Official Synonym Symbols
PPKB; AQP-5
NCBI Protein Information
aquaporin-5
UniProt Protein Name
Aquaporin-5
Protein Family
UniProt Gene Name
AQP5
UniProt Synonym Gene Names
AQP-5
UniProt Entry Name
AQP5_HUMAN

NCBI Description

Aquaporin 5 (AQP5) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions. AQP0, AQP2, AQP5, and AQP6 are closely related and all map to 12q13. [provided by RefSeq, Jul 2008]

Uniprot Description

AQP5: Forms a water-specific channel. Implicated in the generation of saliva, tears, and pulmonary secretions. Belongs to the MIP/aquaporin (TC 1.A.8) family.

Protein type: Transporter; Membrane protein, multi-pass; Transporter, aquaporin family; Membrane protein, integral; Channel, misc.

Chromosomal Location of Human Ortholog: 12q13

Cellular Component: microvillus; endoplasmic reticulum; integral to plasma membrane; apical plasma membrane; plasma membrane; basal plasma membrane

Molecular Function: protein binding; water channel activity; glycerol channel activity

Biological Process: odontogenesis; glycerol transport; cellular water homeostasis; camera-type eye morphogenesis; water transport; carbon dioxide transport; excretion; pancreatic juice secretion; transmembrane transport; saliva secretion

Research Articles on AQP5

Similar Products

Product Notes

The AQP5 aqp5 (Catalog #AAA3211392) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AQP5 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's AQP5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AQP5 aqp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RFSPAHWVFW VGPIVGAVLA AILYFYLLFP NSLSLSERVA IIKGTYEPDE. It is sometimes possible for the material contained within the vial of "AQP5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.