Western Blot (WB)
(Host: RabbitTarget Name: APPDSample Tissue: Human Jurkat Whole cellAntibody Dilution: 1ug/ml)
Rabbit APPD Polyclonal Antibody | anti-PLEKHF1 antibody
APPD antibody - C-terminal region
Gene Names
PLEKHF1; APPD; LAPF; PHAFIN1; ZFYVE15
Reactivity
Cow, Dog, Human, Mouse, Rat, Yeast
Applications
Western Blot
Purity
Protein A purified
Synonyms
APPD; Polyclonal Antibody; APPD antibody - C-terminal region; anti-PLEKHF1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS
Sequence Length
279
Applicable Applications for anti-PLEKHF1 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Human: 100%; Mouse: 92%; Rat: 92%; Yeast: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human APPD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: APPDSample Tissue: Human Jurkat Whole cellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: APPDSample Tissue: Human Jurkat Whole cellAntibody Dilution: 1ug/ml)
Related Product Information for anti-PLEKHF1 antibody
This is a rabbit polyclonal antibody against APPD. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: APPD (Apoptosis-inducing protein D; phafin 1) is predicted through gene annotation and contains pleckstrin homology domain. It may binds to two Zn++ ions through its FYVE zinc finger domain. Biological function of this protein has not been clearly mapped yet.
Target Description: APPD (Apoptosis-inducing protein D; phafin 1) is predicted through gene annotation and contains pleckstrin homology domain. It may binds to two Zn++ ions through its FYVE zinc finger domain. Biological function of this protein has not been clearly mapped yet.
Product Categories/Family for anti-PLEKHF1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31kDa
NCBI Official Full Name
pleckstrin homology domain-containing family F member 1
NCBI Official Synonym Full Names
pleckstrin homology and FYVE domain containing 1
NCBI Official Symbol
PLEKHF1
NCBI Official Synonym Symbols
APPD; LAPF; PHAFIN1; ZFYVE15
NCBI Protein Information
pleckstrin homology domain-containing family F member 1
Protein Family
Research Articles on PLEKHF1
Similar Products
Product Notes
The PLEKHF1 (Catalog #AAA3224459) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APPD antibody - C-terminal region reacts with Cow, Dog, Human, Mouse, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's APPD can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PLEKHF1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QPAHLARPIC GASSGDDDDS DEDKEGSRDG DWPSSVEFYA SGVAWSAFHS. It is sometimes possible for the material contained within the vial of "APPD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
