Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse Apolipoprotein AI Polyclonal Antibody | anti-APOA1 antibody

Apolipoprotein AI (Apo AI, ApoA-I, Apolipoprotein A1, APOA1) (MaxLight 405)

Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Apolipoprotein AI; Polyclonal Antibody; Apolipoprotein AI (Apo AI; ApoA-I; Apolipoprotein A1; APOA1) (MaxLight 405); anti-APOA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human APOA1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-APOA1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human APOA1, aa1-267 (NP_000030.1).
Immunogen Sequence
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Conjugate
MaxLight405
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-APOA1 antibody
Apolipoprotein AI promotes cholesterol efflux from tissues to the liver for excretion. Apolipoprotein AI is the major protein component of high density lipoprotein (HDL) in the plasma. Synthesized in the liver and small intestine, it consists of two identical chains of 77aa; an 18aa signal peptide is removed co-translationally and a 6aa propeptide is cleaved post-translationally. Apolipoprotein A I is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. Defects in the Apolipoprotein A I gene are associated with HDL deficiency and Tangier disease. The therapeutic potential of apoA-I has been recently assessed in patients with acute coronary syndromes, using a recombinant form of a naturally occurring variant of apoA-I. The availability of recombinant normal apoA-I should facilitate further investigation into the potential usefulness of apoA-I in preventing atherosclerotic vascular diseases.
Product Categories/Family for anti-APOA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
335
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,000
NCBI Official Full Name
apolipoprotein A-I preproprotein
NCBI Official Synonym Full Names
apolipoprotein A-I
NCBI Official Symbol
APOA1
NCBI Protein Information
apolipoprotein A-I; apo-AI
UniProt Protein Name
Apolipoprotein A-I
Protein Family
UniProt Gene Name
APOA1
UniProt Synonym Gene Names
Apo-AI; ApoA-I
UniProt Entry Name
APOA1_HUMAN

NCBI Description

This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The protein promotes cholesterol efflux from tissues to the liver for excretion, and it is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. [provided by RefSeq, Jul 2008]

Uniprot Description

APOA1: Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility. Interacts with APOA1BP and CLU. Component of a sperm activating protein complex (SPAP), consisting of APOA1, an immunoglobulin heavy chain, an immunoglobulin light chain and albumin. Interacts with NDRG1. Major protein of plasma HDL, also found in chylomicrons. Synthesized in the liver and small intestine. The oxidized form at Met-110 and Met-136 is increased in individuals with increased risk for coronary artery disease, such as in carrier of the eNOSa/b genotype and exposure to cigarette smoking. It is also present in increased levels in aortic lesions relative to native ApoA-I and increased levels are seen with increasing severity of disease. Belongs to the apolipoprotein A1/A4/E family.

Protein type: Motility/polarity/chemotaxis; Endoplasmic reticulum; Secreted, signal peptide; Secreted; Lipid-binding; Vesicle; Cell development/differentiation

Chromosomal Location of Human Ortholog: 11q23-q24

Cellular Component: extracellular space; chylomicron; cell surface; endocytic vesicle; endoplasmic reticulum lumen; early endosome; plasma membrane; extracellular region; cytoplasmic vesicle; cytosol; nucleus; vesicle

Molecular Function: identical protein binding; protein binding; enzyme binding; phospholipid transporter activity; lipase inhibitor activity; chemorepellent activity; beta-amyloid binding; cholesterol transporter activity; cholesterol binding; phospholipid binding; phosphatidylcholine binding; high-density lipoprotein binding; apolipoprotein A-I receptor binding; apolipoprotein receptor binding

Biological Process: phototransduction, visible light; negative chemotaxis; negative regulation of lipase activity; axon regeneration in the peripheral nervous system; sequestering of lipid; negative regulation of interleukin-1 beta secretion; regulation of cholesterol absorption; transforming growth factor beta receptor signaling pathway; positive regulation of stress fiber formation; response to drug; cholesterol metabolic process; platelet activation; organ regeneration; regulation of Cdc42 protein signal transduction; adrenal gland development; positive regulation of hydrolase activity; positive regulation of Rho protein signal transduction; lipoprotein metabolic process; positive regulation of transferase activity; vitamin transport; cholesterol biosynthetic process; negative regulation of cytokine secretion during immune response; cholesterol homeostasis; lipoprotein biosynthetic process; response to estrogen stimulus; peptidyl-methionine modification; phosphatidylcholine biosynthetic process; positive regulation of lipoprotein lipase activity; blood vessel endothelial cell migration; cellular lipid metabolic process; platelet degranulation; phospholipid efflux; retinoid metabolic process; transmembrane transport; response to nutrient; phospholipid homeostasis; integrin-mediated signaling pathway; receptor-mediated endocytosis; positive regulation of fatty acid biosynthetic process; regulation of protein amino acid phosphorylation; cholesterol transport; protein amino acid oxidation; protein stabilization; negative regulation of heterotypic cell-cell adhesion; neurite regeneration; cholesterol efflux; glucocorticoid metabolic process; G-protein coupled receptor protein signaling pathway; reverse cholesterol transport; negative regulation of inflammatory response; endothelial cell proliferation; blood coagulation

Disease: Hypoalphalipoproteinemia, Primary; Amyloidosis, Familial Visceral

Research Articles on APOA1

Similar Products

Product Notes

The APOA1 apoa1 (Catalog #AAA6370160) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Apolipoprotein AI (Apo AI, ApoA-I, Apolipoprotein A1, APOA1) (MaxLight 405) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's Apolipoprotein AI can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the APOA1 apoa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Apolipoprotein AI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.