Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit APOF Polyclonal Antibody | anti-APOF antibody

APOF Rabbit pAb

Gene Names
APOF; LTIP; Apo-F
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
APOF; Polyclonal Antibody; APOF Rabbit pAb; Apo-F; LTIP; anti-APOF antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, pH7.3.
Sequence
DLGYDLLMTMAGMSGGPMGLAISAALKPALRSGVQQLIQYYQDQKDANISQPETTKEGLRAISDVSDLEETTTLASFISEV
Applicable Applications for anti-APOF antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:1000
IHC: 1:50-1:100
IF: 1:50-1:100
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human APOF (NP_001629.1).
Cellular Location
Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Related Product Information for anti-APOF antibody
Background: The product of this gene is one of the minor apolipoproteins found in plasma. This protein forms complexes with lipoproteins and may be involved in transport and/or esterification of cholesterol.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
319
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,399 Da
NCBI Official Full Name
apolipoprotein F
NCBI Official Synonym Full Names
apolipoprotein F
NCBI Official Symbol
APOF
NCBI Official Synonym Symbols
LTIP; Apo-F
NCBI Protein Information
apolipoprotein F; lipid transfer inhibitor protein
UniProt Protein Name
Apolipoprotein F
Protein Family
UniProt Gene Name
APOF
UniProt Synonym Gene Names
Apo-F; LTIP
UniProt Entry Name
APOF_HUMAN

NCBI Description

The product of this gene is one of the minor apolipoproteins found in plasma. This protein forms complexes with lipoproteins and may be involved in transport and/or esterification of cholesterol. [provided by RefSeq, Jul 2008]

Uniprot Description

APOF: Minor apolipoprotein that associates with LDL. Inhibits cholesteryl ester transfer protein (CETP) activity and appears to be an important regulator of cholesterol transport. Also associates to a lesser degree with VLDL, Apo-AI and Apo-AII.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 12q13.3

Cellular Component: extracellular region

Molecular Function: lipid transporter activity; cholesterol binding; receptor binding

Biological Process: cholesterol metabolic process; triacylglycerol metabolic process; cholesterol efflux; lipid metabolic process; lipid transport

Research Articles on APOF

Similar Products

Product Notes

The APOF apof (Catalog #AAA9142441) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOF Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's APOF can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:1000 IHC: 1:50-1:100 IF: 1:50-1:100. Researchers should empirically determine the suitability of the APOF apof for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DLGYDLLMTM AGMSGGPMGL AISAALKPAL RSGVQQLIQY YQDQKDANIS QPETTKEGLR AISDVSDLEE TTTLASFISE V. It is sometimes possible for the material contained within the vial of "APOF, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.