Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Apoa1 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Muscle)

Rabbit Apoa1 Polyclonal Antibody | anti-APOA1 antibody

Apoa1 antibody - N-terminal region

Gene Names
Apoa1; apoA-I
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Apoa1; Polyclonal Antibody; Apoa1 antibody - N-terminal region; anti-APOA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LVFLTGCQAWEFWQQDEPQSQWDRVKDFATVYVDAVKDSGRDYVSQFESS
Sequence Length
259
Applicable Applications for anti-APOA1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Horse: 79%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 79%; Rat: 93%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Apoa1 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Muscle)

Western Blot (WB) (WB Suggested Anti-Apoa1 AntibodyTitration: 1.0 ug/mlPositive Control: Rat Muscle)
Related Product Information for anti-APOA1 antibody
This is a rabbit polyclonal antibody against Apoa1. It was validated on Western Blot

Target Description: Apoa1 is a major component of high density lipoprotein (HDL) that is involved in intercellular cholesterol transport in astrocytes; cofactor for lecithin cholesterolacyltransferase (LCAT)。
Product Categories/Family for anti-APOA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
apolipoprotein A-I preproprotein
NCBI Official Synonym Full Names
apolipoprotein A1
NCBI Official Symbol
Apoa1
NCBI Official Synonym Symbols
apoA-I
NCBI Protein Information
apolipoprotein A-I
UniProt Protein Name
Apolipoprotein A-I
Protein Family
UniProt Gene Name
Apoa1
UniProt Synonym Gene Names
Apo-AI; ApoA-I; ProapoA-I
UniProt Entry Name
APOA1_RAT

NCBI Description

major component of high density lipoprotein (HDL) that is involved in intercellular cholesterol transport in astrocytes; cofactor for lecithin cholesterolacyltransferase (LCAT) [RGD, Feb 2006]

Uniprot Description

APOA1: Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility. Interacts with APOA1BP and CLU. Component of a sperm activating protein complex (SPAP), consisting of APOA1, an immunoglobulin heavy chain, an immunoglobulin light chain and albumin. Interacts with NDRG1. Major protein of plasma HDL, also found in chylomicrons. Synthesized in the liver and small intestine. The oxidized form at Met-110 and Met-136 is increased in individuals with increased risk for coronary artery disease, such as in carrier of the eNOSa/b genotype and exposure to cigarette smoking. It is also present in increased levels in aortic lesions relative to native ApoA-I and increased levels are seen with increasing severity of disease. Belongs to the apolipoprotein A1/A4/E family.

Protein type: G protein, monomeric, non-Rab; Cell development/differentiation; Transporter; Inhibitor; Endoplasmic reticulum; Vesicle; Motility/polarity/chemotaxis; Lipid-binding; Secreted; Secreted, signal peptide

Cellular Component: cell surface; chylomicron; cytoplasmic vesicle; endocytic vesicle; extracellular region; extracellular space; nucleus

Molecular Function: apolipoprotein A-I receptor binding; apolipoprotein receptor binding; beta-amyloid binding; chemorepellent activity; cholesterol binding; cholesterol transporter activity; enzyme binding; high-density lipoprotein binding; identical protein binding; lipase inhibitor activity; lipid binding; lipid transporter activity; phosphatidylcholine binding; phospholipid binding; phospholipid transporter activity

Biological Process: adrenal gland development; axon regeneration; axon regeneration in the peripheral nervous system; blood vessel endothelial cell migration; cholesterol biosynthetic process; cholesterol efflux; cholesterol homeostasis; cholesterol metabolic process; cholesterol transport; endothelial cell proliferation; G-protein coupled receptor protein signaling pathway; glucocorticoid metabolic process; integrin-mediated signaling pathway; lipoprotein biosynthetic process; lipoprotein metabolic process; negative chemotaxis; negative regulation of cytokine secretion during immune response; negative regulation of heterotypic cell-cell adhesion; negative regulation of hydrolase activity; negative regulation of inflammatory response; negative regulation of interleukin-1 beta secretion; negative regulation of lipase activity; organ regeneration; peptidyl-methionine modification; phosphatidylcholine biosynthetic process; phosphatidylcholine metabolic process; phospholipid efflux; phospholipid homeostasis; phospholipid metabolic process; phospholipid transport; positive regulation of fatty acid biosynthetic process; positive regulation of hydrolase activity; positive regulation of lipoprotein lipase activity; positive regulation of Rho protein signal transduction; positive regulation of stress fiber formation; protein amino acid oxidation; protein localization; protein stabilization; regulation of Cdc42 protein signal transduction; regulation of cholesterol absorption; regulation of protein amino acid phosphorylation; response to drug; response to estrogen stimulus; response to nutrient; reverse cholesterol transport; sequestering of lipid; transforming growth factor beta receptor signaling pathway; triacylglycerol catabolic process; vitamin transport

Research Articles on APOA1

Similar Products

Product Notes

The APOA1 apoa1 (Catalog #AAA3211572) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Apoa1 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Apoa1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APOA1 apoa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LVFLTGCQAW EFWQQDEPQS QWDRVKDFAT VYVDAVKDSG RDYVSQFESS. It is sometimes possible for the material contained within the vial of "Apoa1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.