Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: APLP2Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human, Mouse APLP2 Polyclonal Antibody | anti-APLP2 antibody

APLP2 Antibody - middle region

Gene Names
APLP2; APPH; APPL2; CDEBP; APLP-2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
APLP2; Polyclonal Antibody; APLP2 Antibody - middle region; anti-APLP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DEEEGEEVVEDRDYYYDTFKGDDYNEENPTEPGSDGTMSDKEITHDVKAV
Sequence Length
761
Applicable Applications for anti-APLP2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human APLP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: APLP2Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: APLP2Sample Type: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-APLP2 antibody
This is a rabbit polyclonal antibody against APLP2. It was validated on Western Blot

Target Description: This gene encodes amyloid precursor- like protein 2 (APLP2), which is a member of the APP (amyloid precursor protein) family including APP, APLP1 and APLP2. This protein is ubiquitously expressed. It contains heparin-, copper- and zinc- binding domains at the N-terminus, BPTI/Kunitz inhibitor and E2 domains in the middle region, and transmembrane and intracellular domains at the C-terminus. This protein interacts with major histocompatibility complex (MHC) class I molecules. The synergy of this protein and the APP is required to mediate neuromuscular transmission, spatial learning and synaptic plasticity. This protein has been implicated in the pathogenesis of Alzheimer's disease. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.
Product Categories/Family for anti-APLP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
334
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
amyloid-like protein 2 isoform 2
NCBI Official Synonym Full Names
amyloid beta precursor like protein 2
NCBI Official Symbol
APLP2
NCBI Official Synonym Symbols
APPH; APPL2; CDEBP; APLP-2
NCBI Protein Information
amyloid-like protein 2
UniProt Protein Name
Amyloid-like protein 2
Protein Family
UniProt Gene Name
APLP2
UniProt Synonym Gene Names
APPL2; APLP-2; CDEBP
UniProt Entry Name
APLP2_HUMAN

NCBI Description

This gene encodes amyloid precursor- like protein 2 (APLP2), which is a member of the APP (amyloid precursor protein) family including APP, APLP1 and APLP2. This protein is ubiquitously expressed. It contains heparin-, copper- and zinc- binding domains at the N-terminus, BPTI/Kunitz inhibitor and E2 domains in the middle region, and transmembrane and intracellular domains at the C-terminus. This protein interacts with major histocompatibility complex (MHC) class I molecules. The synergy of this protein and the APP is required to mediate neuromuscular transmission, spatial learning and synaptic plasticity. This protein has been implicated in the pathogenesis of Alzheimer's disease. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]

Uniprot Description

APLP2: May play a role in the regulation of hemostasis. The soluble form may have inhibitory properties towards coagulation factors. May interact with cellular G-protein signaling pathways. May bind to the DNA 5'-GTCACATG-3'(CDEI box). Inhibits trypsin, chymotrypsin, plasmin, factor XIA and plasma and glandular kallikrein. Modulates the Cu/Zn nitric oxide-catalyzed autodegradation of GPC1 heparan sulfate side chains in fibroblasts. Belongs to the APP family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Membrane protein, integral; Cell surface; Receptor, misc.

Chromosomal Location of Human Ortholog: 11q24

Cellular Component: membrane; integral to membrane; plasma membrane; nucleus

Molecular Function: heparin binding; serine-type endopeptidase inhibitor activity; identical protein binding; protein binding; DNA binding; transition metal ion binding

Biological Process: cholesterol metabolic process; G-protein coupled receptor protein signaling pathway; extracellular matrix organization and biogenesis; cellular copper ion homeostasis; suckling behavior; regulation of protein binding; forebrain development; midbrain development; regulation of epidermal growth factor receptor activity; mating behavior; locomotory behavior; neuromuscular process controlling balance

Research Articles on APLP2

Similar Products

Product Notes

The APLP2 aplp2 (Catalog #AAA3219404) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APLP2 Antibody - middle region reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's APLP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APLP2 aplp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DEEEGEEVVE DRDYYYDTFK GDDYNEENPT EPGSDGTMSD KEITHDVKAV. It is sometimes possible for the material contained within the vial of "APLP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.