Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- APH1a Picoband antibody, MBS178259, Western blottingAll lanes: Anti APH1a (MBS178259) at 0.5ug/mlLane 1: Mouse Lung Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: SW620 Whole Cell Lysate at 40ugLane 4: SMMC Whole Cell Lysate at 40ugLane 5: Human Placenta Tissue Lysate at 50ugPredicted bind size: 29KDObserved bind size: 29KD )

anti-Human, Mouse APH1a Polyclonal Antibody | anti-APH1A antibody

Anti-APH1a Antibody

Gene Names
APH1A; APH-1; APH-1A; CGI-78; 6530402N02Rik
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
APH1a; Polyclonal Antibody; Anti-APH1a Antibody; Gamma-secretase subunit APH-1; 6530402N02Rik; AL138795.3; Anterior Pharynx Defective 1; Anterior pharynx defective 1 homolog A; APH 1A; Aph 1alpha; APH-1a; Aph-1alpha; Aph1a; APH1A gamma secretase subunit; APH1A_HUMAN; CGI 78; CGI78; Gamma secretase subunit APH 1A; Gamma Secretase Subunit APH1a; Gamma-secretase subunit APH-1A; Likely ortholog of C. elegans anterior pharynx defective 1A; Presenilin Stabilization Factor; Presenilin-stabilization factor; PSF; UNQ579/PRO1141; anti-APH1A antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
265
Applicable Applications for anti-APH1A antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human APH1a (236-265aa LRSIQRSLLCRRQEDSRVMVYSALRIPPED), different from the related mouse sequence by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- APH1a Picoband antibody, MBS178259, Western blottingAll lanes: Anti APH1a (MBS178259) at 0.5ug/mlLane 1: Mouse Lung Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: SW620 Whole Cell Lysate at 40ugLane 4: SMMC Whole Cell Lysate at 40ugLane 5: Human Placenta Tissue Lysate at 50ugPredicted bind size: 29KDObserved bind size: 29KD )

Western Blot (WB) (Anti- APH1a Picoband antibody, MBS178259, Western blottingAll lanes: Anti APH1a (MBS178259) at 0.5ug/mlLane 1: Mouse Lung Tissue Lysate at 50ugLane 2: Mouse Liver Tissue Lysate at 50ugLane 3: SW620 Whole Cell Lysate at 40ugLane 4: SMMC Whole Cell Lysate at 40ugLane 5: Human Placenta Tissue Lysate at 50ugPredicted bind size: 29KDObserved bind size: 29KD )
Related Product Information for anti-APH1A antibody
Description: Rabbit IgG polyclonal antibody for Gamma-secretase subunit APH-1(APH1A) detection. Tested with WB in Human;Mouse.

Background: APH1a encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants.
References
1. Qin W; Jia L; Zhou A; Zuo X; Cheng Z; Wang F; Shi F; Jia J: The -980C/G polymorphism in APH-1A promoter confers risk of Alzheimer's disease. Aging Cell, 2011 Aug.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20,977 Da
NCBI Official Full Name
gamma-secretase subunit APH-1A isoform 1
NCBI Official Synonym Full Names
aph-1 homolog A, gamma secretase subunit
NCBI Official Symbol
APH1A
NCBI Official Synonym Symbols
APH-1; APH-1A; CGI-78; 6530402N02Rik
NCBI Protein Information
gamma-secretase subunit APH-1A
UniProt Protein Name
Gamma-secretase subunit APH-1A
Protein Family
UniProt Gene Name
APH1A
UniProt Synonym Gene Names
PSF; APH-1a
UniProt Entry Name
APH1A_HUMAN

NCBI Description

This gene encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants. [provided by RefSeq, Aug 2011]

Uniprot Description

APH1A: Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors and APP (beta-amyloid precursor protein). It probably represents a stabilizing cofactor for the presenilin homodimer that promotes the formation of a stable complex. Belongs to the APH-1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Apoptosis; Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 1p36.13-q31.3

Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; Golgi apparatus; integral to plasma membrane; membrane; plasma membrane

Molecular Function: endopeptidase activity; protein binding

Biological Process: amyloid precursor protein catabolic process; ephrin receptor signaling pathway; membrane protein ectodomain proteolysis; membrane protein intracellular domain proteolysis; metanephros development; Notch receptor processing; Notch signaling pathway; positive regulation of apoptosis; positive regulation of catalytic activity; protein processing

Research Articles on APH1A

Similar Products

Product Notes

The APH1A aph1a (Catalog #AAA178259) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-APH1a Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's APH1a can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the APH1A aph1a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APH1a, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.