Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-APEX1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateAPEX1 is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit anti-Human, Pig APEX1 Polyclonal Antibody | anti-APEX1 antibody

APEX1 antibody - N-terminal region

Gene Names
APEX1; APE; APX; APE1; APEN; APEX; HAP1; REF1
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
APEX1; Polyclonal Antibody; APEX1 antibody - N-terminal region; anti-APEX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPD
Sequence Length
318
Applicable Applications for anti-APEX1 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human APEX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-APEX1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateAPEX1 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-APEX1 Antibody Titration: 0.2-1 ug/mlPositive Control: MCF7 cell lysateAPEX1 is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-APEX1 antibody
This is a rabbit polyclonal antibody against APEX1. It was validated on Western Blot

Target Description: Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
328
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
DNA-(apurinic or apyrimidinic site) lyase
NCBI Official Synonym Full Names
apurinic/apyrimidinic endodeoxyribonuclease 1
NCBI Official Symbol
APEX1
NCBI Official Synonym Symbols
APE; APX; APE1; APEN; APEX; HAP1; REF1
NCBI Protein Information
DNA-(apurinic or apyrimidinic site) lyase
UniProt Protein Name
DNA-(apurinic or apyrimidinic site) lyase
UniProt Gene Name
APEX1
UniProt Synonym Gene Names
APE; APE1; APEX; APX; HAP1; REF1; APEN; AP endonuclease 1; APE-1
UniProt Entry Name
APEX1_HUMAN

NCBI Description

Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

APE1: a multifunctional enzyme that plays a central role in the cellular response to oxidative stress including DNA repair and redox regulation of transcriptional factors. Binds DNA and RNA. Functions as an apurinic/apyrimidinic (AP) endodeoxyribonuclease in the DNA base excision repair (BER) pathway, a 3'-5' exoribonuclease for mismatched deoxyribonucleotides at the 3' termini of nicked or gapped DNA molecules, and a DNA 3' phosphodiesterase capable of removing lesions (such as phosphoglycolate) blocking the 3' side of DNA strand breaks. Is a loading factor for POLB onto non-incised AP sites in DNA, stimulates the 5'-terminal deoxyribose 5'- phosphate (dRp) excision activity of POLB, and involved in the DNA cleavage step of class switch recombination (CSR). Possesses reversible nuclear redox activity to regulate DNA binding affinity and transcriptional activity of transcriptional factors by controlling the redox status of their DNA-binding domain, such as the FOS/JUN AP-1 complex after exposure to IR. Binds to negative calcium response elements (nCaREs). Stimulates the YBX1-mediated MDR1 promoter activity, when acetylated at Lys-6 and Lys-7, leading to drug resistance. Is an endoribonuclease involved in the control of single-stranded RNA metabolism. Plays a role in regulating MYC mRNA turnover. In association with NMD1, plays a role in the rRNA quality control process during cell cycle progression. Interacts with SIRT1; the interaction is increased in the context of genotoxic stress. Interacts with HDAC1, HDAC2 and HDAC3; the interactions are not dependent on the APEX1 acetylation status. Up-regulated in presence of reactive oxygen species (ROS), like bleomycin, H2O2 and phenazine methosulfate. NPM1 stimulates endodeoxyribonuclease activity on double-stranded DNA with AP sites, but inhibits endoribonuclease activity on single-stranded RNA containing AP sites. Belongs to the DNA repair enzymes AP/ExoA family.

Protein type: DNA-binding; EC 4.2.99.18; Nuclear receptor co-regulator; Deoxyribonuclease; Nucleolus; DNA repair, damage; Hydrolase; Endoplasmic reticulum; Lyase; Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: nucleoplasm; centrosome; transcription factor complex; mitochondrion; endoplasmic reticulum; perinuclear region of cytoplasm; cytoplasm; nucleolus; ribosome; nuclear speck; nucleus

Molecular Function: phosphodiesterase I activity; DNA-(apurinic or apyrimidinic site) lyase activity; phosphoric diester hydrolase activity; uracil DNA N-glycosylase activity; chromatin DNA binding; metal ion binding; transcription coactivator activity; oxidoreductase activity; endodeoxyribonuclease activity; NF-kappaB binding; protein binding; DNA binding; endonuclease activity; protein complex binding; damaged DNA binding; ribonuclease H activity; 3'-5' exonuclease activity; transcription corepressor activity; double-stranded DNA specific 3'-5' exodeoxyribonuclease activity; site-specific endodeoxyribonuclease activity, specific for altered base

Biological Process: response to drug; positive regulation of DNA repair; mismatch repair; transcription, DNA-dependent; negative regulation of smooth muscle cell migration; DNA strand elongation during DNA replication; DNA repair; regulation of mRNA stability; DNA catabolic process, endonucleolytic; double-strand break repair via homologous recombination; telomere maintenance via semi-conservative replication; regulation of transcription, DNA-dependent; cell redox homeostasis; nucleotide-excision repair; base-excision repair; transcription-coupled nucleotide-excision repair; double-strand break repair; telomere maintenance via recombination; nucleotide-excision repair, DNA gap filling; mitotic cell cycle; DNA catabolic process, exonucleolytic; telomere maintenance; aging

Research Articles on APEX1

Similar Products

Product Notes

The APEX1 apex1 (Catalog #AAA3213703) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APEX1 antibody - N-terminal region reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's APEX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the APEX1 apex1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPKRGKKGAV AEDGDELRTE PEAKKSKTAA KKNDKEAAGE GPALYEDPPD. It is sometimes possible for the material contained within the vial of "APEX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.