Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of APC2 expression in HELA whole cell lysates (lane 1). APC2 at 94KD was detected using rabbit anti- APC2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human APC2 Polyclonal Antibody | anti-APC2 antibody

Anti-APC2 Antibody

Gene Names
APC2; APCL; SOTOS3
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
APC2; Polyclonal Antibody; Anti-APC2 Antibody; APCL; APC 2; O95996; Adenomatous polyposis coli protein 2; WNT signaling pathway regulator; anti-APC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
2303
Applicable Applications for anti-APC2 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human APC2 (51-90aa KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK), different from the related mouse sequence by two amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of APC2 expression in HELA whole cell lysates (lane 1). APC2 at 94KD was detected using rabbit anti- APC2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of APC2 expression in HELA whole cell lysates (lane 1). APC2 at 94KD was detected using rabbit anti- APC2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-APC2 antibody
Rabbit IgG polyclonal antibody for Adenomatous polyposis coli protein 2(APC2) detection.
Background: APC2, which is also called APCL, is a deduced 2, 303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.
References
1. Nakagawa, H., Murata, Y., Koyama, K., Fujiyama, A., Miyoshi, Y., Monden, M., Akiyama, T., Nakamura, Y. Identification of a brain-specific APC homologue, APCL, and its interaction with beta-catenin. Cancer Res. 58: 5176-5181, 1998.
2. van Es, J. H., Kirkpatrick, C., van de Wetering, M., Molenaar, M., Miles, A., Kuipers, J., Destree, O., Peifer, M., Clevers, H.Identification of APC2, a homologue of the adenomatous polyposis coli tumour suppressor. Curr. Biol. 9: 105-108, 1999.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
243,821 Da
NCBI Official Full Name
adenomatous polyposis coli protein 2
NCBI Official Synonym Full Names
APC2, WNT signaling pathway regulator
NCBI Official Symbol
APC2
NCBI Official Synonym Symbols
APCL; SOTOS3
NCBI Protein Information
adenomatous polyposis coli protein 2
UniProt Protein Name
Adenomatous polyposis coli protein 2
Protein Family
UniProt Gene Name
APC2
UniProt Synonym Gene Names
APCL; APC-like

Uniprot Description

APCL: Promotes rapid degradation of CTNNB1 and may function as a tumor suppressor. May function in Wnt signaling. Belongs to the adenomatous polyposis coli (APC) family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, peripheral

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: actin filament; beta-catenin destruction complex; catenin complex; cytoplasm; cytoplasmic microtubule; filamentous actin; Golgi apparatus; microtubule cytoskeleton; perinuclear region of cytoplasm

Molecular Function: beta-catenin binding; gamma-catenin binding; protein binding

Biological Process: cell fate specification; cell migration; cell proliferation; microtubule cytoskeleton organization and biogenesis; negative regulation of microtubule depolymerization; pattern specification process; positive regulation of protein catabolic process; regulation of cell differentiation

Disease: Sotos Syndrome 3

Research Articles on APC2

Similar Products

Product Notes

The APC2 apc2 (Catalog #AAA178797) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-APC2 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's APC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the APC2 apc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "APC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.