Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: AP3B2Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit AP3B2 Polyclonal Antibody | anti-AP3B2 antibody

AP3B2 Antibody - C-terminal region

Gene Names
AP3B2; NAPTB; EIEE48
Applications
Western Blot
Purity
Affinity purified
Synonyms
AP3B2; Polyclonal Antibody; AP3B2 Antibody - C-terminal region; anti-AP3B2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEFAEFIDSLFNLDSKSSSFQDLYCMVVPESPTSDYAEGPKSPSQQEILL
Sequence Length
115
Applicable Applications for anti-AP3B2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human AP3B2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AP3B2Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: AP3B2Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-AP3B2 antibody
Adaptor protein-3 (AP3) is a heterotetrameric vesicle-coat protein complex. Some AP3 subunits are ubiquitously expressed, whereas others are expressed exclusively in neurons. The neuron-specific AP3 complex, which includes AP3B2, is thought to serve neuron-specific functions such as neurotransmitter release.
Product Categories/Family for anti-AP3B2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
1050
NCBI Official Full Name
AP-3 complex subunit beta-2 isoform 3
NCBI Official Synonym Full Names
adaptor related protein complex 3 subunit beta 2
NCBI Official Symbol
AP3B2
NCBI Official Synonym Symbols
NAPTB; EIEE48
NCBI Protein Information
AP-3 complex subunit beta-2
UniProt Protein Name
AP-3 complex subunit beta-2
Protein Family
UniProt Gene Name
AP3B2
UniProt Entry Name
AP3B2_HUMAN

NCBI Description

Adaptor protein complex 3 (AP-3 complex) is a heterotrimeric protein complex involved in the formation of clathrin-coated synaptic vesicles. The protein encoded by this gene represents the beta subunit of the neuron-specific AP-3 complex and was first identified as the target antigen in human paraneoplastic neurologic disorders. The encoded subunit binds clathrin and is phosphorylated by a casein kinase-like protein, which mediates synaptic vesicle coat assembly. Defects in this gene are a cause of early-onset epileptic encephalopathy. [provided by RefSeq, Feb 2017]

Uniprot Description

AP3B2: Subunit of non-clathrin- and clathrin-associated adaptor protein complex 3 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. AP-3 appears to be involved in the sorting of a subset of transmembrane proteins targeted to lysosomes and lysosome-related organelles. Belongs to the adaptor complexes large subunit family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 15q

Cellular Component: nucleoplasm; Golgi apparatus; COPI-coated vesicle; cytoplasm; clathrin coated vesicle membrane

Molecular Function: transporter activity

Biological Process: intracellular protein transport; anterograde synaptic vesicle transport; post-Golgi vesicle-mediated transport; anterograde axon cargo transport

Research Articles on AP3B2

Similar Products

Product Notes

The AP3B2 ap3b2 (Catalog #AAA3222051) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AP3B2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AP3B2 ap3b2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEFAEFIDSL FNLDSKSSSF QDLYCMVVPE SPTSDYAEGP KSPSQQEILL. It is sometimes possible for the material contained within the vial of "AP3B2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.