Western Blot (WB)
(Host: RabbitTarget Name: AP1ARSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit AP1AR Polyclonal Antibody | anti-AP1AR antibody
AP1AR Antibody - C-terminal region
Gene Names
AP1AR; 2C18; GBAR; C4orf16; PRO0971; gamma-BAR
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AP1AR; Polyclonal Antibody; AP1AR Antibody - C-terminal region; anti-AP1AR antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DSTSLDLEWEDEEGMNRMLPMRERSKTEEDILRAALKYSNKKTGSNPTSA
Sequence Length
302
Applicable Applications for anti-AP1AR antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Horse: 83%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 86%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP1AR
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: AP1ARSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: AP1ARSample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-AP1AR antibody
This is a rabbit polyclonal antibody against AP1AR. It was validated on Western Blot
Target Description: AP1AR is necessary for AP-1 dependent transport between the trans-Golgi network and endosomes. It regulates the membrane association of AP1G1/Gamma1-adaptin, one of the subunits of the AP-1 adapter complex. The direct interaction with AP1G1/Gamma1-adaptin attenuates the release of the AP-1 complex from membranes.
Target Description: AP1AR is necessary for AP-1 dependent transport between the trans-Golgi network and endosomes. It regulates the membrane association of AP1G1/Gamma1-adaptin, one of the subunits of the AP-1 adapter complex. The direct interaction with AP1G1/Gamma1-adaptin attenuates the release of the AP-1 complex from membranes.
Product Categories/Family for anti-AP1AR antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
AP-1 complex-associated regulatory protein isoform 1
NCBI Official Synonym Full Names
adaptor related protein complex 1 associated regulatory protein
NCBI Official Symbol
AP1AR
NCBI Official Synonym Symbols
2C18; GBAR; C4orf16; PRO0971; gamma-BAR
NCBI Protein Information
AP-1 complex-associated regulatory protein
UniProt Protein Name
AP-1 complex-associated regulatory protein
Protein Family
UniProt Gene Name
AP1AR
UniProt Synonym Gene Names
C4orf16; GBAR; Gamma-BAR; Gadkin
UniProt Entry Name
AP1AR_HUMAN
Uniprot Description
AP1AR: Necessary for AP-1 dependent transport between the trans-Golgi network and endosomes. Regulates the membrane association of AP1G1/Gamma1-adaptin, one of the subunits of the AP-1 adapter complex. The direct interaction with AP1G1/Gamma1- adaptin attenuates the release of the AP-1 complex from membranes. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Vesicle
Chromosomal Location of Human Ortholog: 4q25
Cellular Component: Golgi apparatus; transport vesicle; late endosome; early endosome
Molecular Function: kinesin binding
Biological Process: protein transport; negative regulation of receptor recycling; vesicle targeting, trans-Golgi to endosome
Research Articles on AP1AR
Similar Products
Product Notes
The AP1AR ap1ar (Catalog #AAA3217928) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AP1AR Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AP1AR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AP1AR ap1ar for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DSTSLDLEWE DEEGMNRMLP MRERSKTEED ILRAALKYSN KKTGSNPTSA. It is sometimes possible for the material contained within the vial of "AP1AR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
