Western Blot (WB)
(AOC2 antibody (retina specific) (MBS839692) used at 1 ug/ml to detect target protein.)
Rabbit AOC2 Polyclonal Antibody | anti-AOC2 antibody
AOC2 antibody (retina specific)
Gene Names
AOC2; allene oxide cyclase 2; AOC2
Applications
Western Blot
Purity
Affinity purified
Synonyms
AOC2; Polyclonal Antibody; AOC2 antibody (retina specific); Polyclonal AOC2 (retina specific); Anti-AOC2 (retina specific); RAO; DAO2; Amine Oxidase Copper Containing 2; anti-AOC2 antibody
Host
Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AOC2 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
253
Applicable Applications for anti-AOC2 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Copper amine oxidases catalyze the oxidative conversion of amines to aldehydes and ammonia in the presence of copper and quinone cofactor. The protein contains several conserved motifs including the active site of amine oxidases and the histidine residues that likely bind copper. It may be a critical modulator of signal transmission in retina, possibly by degrading the biogenic amines dopamine, histamine, and putrescine.
Cross-Reactivity
Human
Immunogen
AOC2 antibody (retina specific) was raised using a synthetic peptide corresponding to a region with amino acids AEDIPNTVTLGNRVGFLLRPYNFFDEDPSIFSPGSVYFEKGQDAGLCSIN
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(AOC2 antibody (retina specific) (MBS839692) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(AOC2 antibody (retina specific) (MBS839692) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-AOC2 antibody
Rabbit polyclonal AOC2 antibody (retina specific)
Product Categories/Family for anti-AOC2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
84 kDa (MW of target protein)
NCBI Official Full Name
allene oxide cyclase 2
NCBI Official Symbol
AOC2
NCBI Official Synonym Symbols
allene oxide cyclase 2; AOC2
NCBI Protein Information
allene oxide cyclase 2
UniProt Protein Name
Allene oxide cyclase 2, chloroplastic
Protein Family
UniProt Gene Name
AOC2
UniProt Entry Name
AOC2_ARATH
NCBI Description
Encodes allene oxide cyclase. One of four genes in Arabidopsis that encode this enzyme, which catalyzes an essential step in jasmonic acid biosynthesis. Gene expression is induced during senescence, a process that involves jasmonic acid signalling pathway. Note: Nomenclature for Arabidopsis allene oxide cyclase 2 (AOC2, AT3G25770) gene is based on Stenzel et al. 2003 Plant Molecular Biology 51:895-911. AOC2 (AT3G25770) is also referred to as AOC3 in He et al. 2002 Plant Physiology, 128:876-884.
Uniprot Description
Involved in the production of 12-oxo-phytodienoic acid (OPDA), a precursor of jasmonic acid.
Similar Products
Product Notes
The AOC2 aoc2 (Catalog #AAA839692) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's AOC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the AOC2 aoc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AOC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
