Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Annexin A4 antibody (MBS839568) used at 1 ug/ml to detect target protein.)

Rabbit Annexin A4 Polyclonal Antibody | anti-ANXA4 antibody

Annexin A4 antibody

Gene Names
ANXA4; ANX4; PIG28; ZAP36; HEL-S-274
Applications
Western Blot
Purity
Affinity purified
Synonyms
Annexin A4; Polyclonal Antibody; Annexin A4 antibody; Polyclonal Annexin A4; Anti-Annexin A4; Annexin A 4; ANXA4; DKFZp686H02120; ANX4; PIG28; MGC75105; Annexin A-4; anti-ANXA4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Annexin A4 antibody was raised against the middle region of ANXA4
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ANXA4 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
321
Applicable Applications for anti-ANXA4 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 gene has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity.
Cross-Reactivity
Human
Immunogen
Annexin A4 antibody was raised using the middle region of ANXA4 corresponding to a region with amino acids EGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Annexin A4 antibody (MBS839568) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Annexin A4 antibody (MBS839568) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-ANXA4 antibody
Rabbit polyclonal Annexin A4 antibody raised against the middle region of ANXA4
Product Categories/Family for anti-ANXA4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
307
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36 kDa (MW of target protein)
NCBI Official Full Name
annexin A4
NCBI Official Synonym Full Names
annexin A4
NCBI Official Symbol
ANXA4
NCBI Official Synonym Symbols
ANX4; PIG28; ZAP36; HEL-S-274
NCBI Protein Information
annexin A4
UniProt Protein Name
Annexin A4
Protein Family
UniProt Gene Name
ANXA4
UniProt Synonym Gene Names
ANX4; PAP-II
UniProt Entry Name
ANXA4_HUMAN

NCBI Description

Annexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. [provided by RefSeq, Jul 2008]

Uniprot Description

ANXA4: a calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion.

Protein type: Calcium-binding; Lipid-binding

Chromosomal Location of Human Ortholog: 2p13

Cellular Component: nuclear membrane; cell surface; perinuclear region of cytoplasm; cytoplasm; plasma membrane; vesicle membrane; nucleus

Molecular Function: phospholipase inhibitor activity; identical protein binding; NF-kappaB binding; calcium-dependent phospholipid binding; calcium ion binding; calcium-dependent protein binding

Biological Process: regulation of transcription from RNA polymerase II promoter; epithelial cell differentiation; inhibition of NF-kappaB transcription factor; negative regulation of catalytic activity; signal transduction; negative regulation of apoptosis

Research Articles on ANXA4

Similar Products

Product Notes

The ANXA4 anxa4 (Catalog #AAA839568) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Annexin A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the ANXA4 anxa4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Annexin A4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.