Western Blot (WB)
(Annexin A2 antibody used at 1.25 ug/ml to detect target protein.)
Rabbit Annexin A2 Polyclonal Antibody | anti-ANXA2 antibody
Annexin A2 Antibody
Reactivity
Human, Mouse, Dog
Applications
Western Blot
Purity
Total IgG Protein A purified
Synonyms
Annexin A2; Polyclonal Antibody; Annexin A2 Antibody; Rabbit Polyclonal Annexin A2 Antibody raised against the C terminal of ANXA2; Polyclonal Annexin A2 antibody; Anti-Annexin A2 antibody; Annexin A 2; Annexin A-2; Annexin A-2 antibody; ANXA2 antibody; Annexin A 2 antibody; anti-ANXA2 antibody
Host
Rabbit
Reactivity
Human, Mouse, Dog
Clonality
Polyclonal
Specificity
Annexin A2 antibody was raised against the C terminal of ANXA2
Purity/Purification
Total IgG Protein A purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Sequence Length
339
Applicable Applications for anti-ANXA2 antibody
Western Blot (WB)
Application Notes
This is a rabbit polyclonal antibody against ANXA2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein.
WB: 1.25 ug/ml
WB: 1.25 ug/ml
Immunogen
Annexin A2 antibody was raised using the C terminal of ANXA2 corresponding to a region with amino acids RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
Cross-Reactivity
Human,Mouse,Dog
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(Annexin A2 antibody used at 1.25 ug/ml to detect target protein.)
Western Blot (WB)
(Annexin A2 antibody used at 1.25 ug/ml to detect target protein.)
Related Product Information for anti-ANXA2 antibody
ANXA2 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. ANXA2 has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for ANXA2.
Product Categories/Family for anti-ANXA2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37 kDa (MW of target protein)
NCBI Official Full Name
annexin A2
NCBI Official Symbol
ANXA2
NCBI Protein Information
annexin A2
UniProt Protein Name
Annexin A2
Protein Family
UniProt Gene Name
ANXA2
UniProt Synonym Gene Names
ANX2; PAP-IV
UniProt Entry Name
ANXA2_PIG
Uniprot Description
Calcium-regulated membrane-binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. May be involved in heat-stress response. Inhibits PCSK9-enhanced LDLR degradation, probably reduces PCSK9 protein levels via a translational mechanism but also competes with LDLR for binding with PCSK9.
Research Articles on ANXA2
Similar Products
Product Notes
The ANXA2 anxa2 (Catalog #AAA5313172) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Annexin A2 Antibody reacts with Human, Mouse, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's Annexin A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). This is a rabbit polyclonal antibody against ANXA2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. WB: 1.25 ug/ml. Researchers should empirically determine the suitability of the ANXA2 anxa2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Annexin A2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
