Western Blot (WB)
(Western Blot: Sample: Rat Lung lysate; Primary Ab: 3ug/ml Rabbit Anti-Rat ANXA1 Antibody;Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody;)
Rabbit anti-Rat Annexin A1 (ANXA1) Polyclonal Antibody | anti-ANXA1 antibody
Polyclonal Antibody to Annexin A1 (ANXA1)
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGS-MAMVSEFLKQ ACYIEKQEQE YVQAVKSYKG GPGSAVSPYP SFNPSSDVAA LHKAIMVKGV DEATIIDILT KRTNAQRQQI KAAYLQETGK PLDETLKKAL TGHLEEVVLA MLKTPAQFDA DELRAAMKGL GTDEDTLIEI LTTRSNQQIR EITRVYREEL KRDLAKDITS DTSGDFRNAL LALAKGDRCE DMSVNQDLAD TDARALYEAG ERRKGTDVNV FNTILTTRSY PHLRKVFQNY RKYSQHDMNK ALDLELKGDI EKCLTTIVKC ATSTPAFFAE KLYEAMKGAG TRHKTLIRIM VSRSEIDMNE IKVFYQKKYG IPLCQAILDE TKGDYEKILV ALCGGN
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Western Blot (WB)
(Western Blot: Sample: Rat Lung lysate; Primary Ab: 3ug/ml Rabbit Anti-Rat ANXA1 Antibody;Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody;)
Western Blot (WB)
(Western Blot: Sample: Rat Lung lysate; Primary Ab: 3ug/ml Rabbit Anti-Rat ANXA1 Antibody;Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody;)
Western Blot (WB)
(Western Blot: Sample: Recombinant protein.)
Western Blot (WB)
(Western Blot: Sample: Recombinant protein.)
Immunohistochemistry (IHC)
(DAB staining on fromalin fixed paraffin-embedded kidney tissue))
Immunohistochemistry (IHC)
(DAB staining on fromalin fixed paraffin-embedded kidney tissue))
NCBI and Uniprot Product Information
NCBI Description
plays a role in regulation of insulin secretion; may inhibit phopsholipase A2 [RGD, Feb 2006]
Uniprot Description
ANXA1: a calcium/phospholipid-binding protein with which promotes membrane fusion and is involved in endocytosis. Has anti-inflammatory properties and inhibits phospholipase A2 activity. Accumulates on internalized vesicles after EGF-stimulated endocytosis, suggesting that it may be required for a late stage in inward vesiculation. Phosphorylated by PKC, EGFR and Chak1. Phosphorylation results in loss of the inhibitory activity. Annexins are a family of structurally related proteins whose common property is calcium-dependent binding to phospholipids. There are at least ten different annexins in mammalian species. Annexins do not contain signal peptides, yet some annexins (A1, A2 and A5) appear to be secreted in a physiologically regulated fashion.
Protein type: Calcium-binding; Lipid-binding
Chromosomal Location of Human Ortholog: 1q51
Cellular Component: apical plasma membrane; basolateral plasma membrane; cell surface; cell-cell adherens junction; cornified envelope; cytoplasm; cytoplasmic vesicle membrane; cytosol; early endosome membrane; endosome; extracellular exosome; extracellular space; extrinsic component of membrane; extrinsic to external side of plasma membrane; focal adhesion; lateral plasma membrane; mast cell granule; mitochondrial membrane; nucleoplasm; nucleus; phagocytic cup; plasma membrane; protein complex; sarcolemma; vesicle
Molecular Function: cadherin binding involved in cell-cell adhesion; calcium ion binding; calcium-dependent phospholipid binding; calcium-dependent protein binding; double-stranded DNA-dependent ATPase activity; helicase activity; phospholipase A2 inhibitor activity; phospholipid binding; protein binding, bridging; protein homodimerization activity; single-stranded DNA binding; single-stranded RNA binding; structural molecule activity
Biological Process: actin cytoskeleton reorganization; adaptive immune response; alpha-beta T cell differentiation; arachidonic acid secretion; cell surface receptor signaling pathway; cellular response to glucocorticoid stimulus; cellular response to hydrogen peroxide; DNA duplex unwinding; DNA strand renaturation; endocrine pancreas development; G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger; gliogenesis; granulocyte chemotaxis; hepatocyte differentiation; inflammatory response; innate immune response; insulin secretion; keratinocyte differentiation; monocyte chemotaxis; myoblast migration involved in skeletal muscle regeneration; negative regulation of exocytosis; negative regulation of interleukin-8 secretion; negative regulation of phospholipase A2 activity; negative regulation of protein secretion; negative regulation of T-helper 2 cell differentiation; neutrophil homeostasis; peptide cross-linking; phagocytosis; positive regulation of apoptosis; positive regulation of G1/S transition of mitotic cell cycle; positive regulation of interleukin-2 production; positive regulation of neutrophil apoptosis; positive regulation of prostaglandin biosynthetic process; positive regulation of T cell proliferation; positive regulation of T-helper 1 cell differentiation; positive regulation of vesicle fusion; positive regulation of wound healing; prostate gland development; regulation of cell proliferation; regulation of cell shape; regulation of hormone secretion; regulation of inflammatory response; regulation of interleukin-1 production; regulation of leukocyte migration; response to corticosteroid stimulus; response to drug; response to estradiol; response to glucocorticoid stimulus; response to hormone; response to organic cyclic compound; response to peptide hormone; response to X-ray; signal transduction
Research Articles on ANXA1
Similar Products
Product Notes
The ANXA1 anxa1 (Catalog #AAA2004740) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Annexin A1 (ANXA1) reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Annexin A1 (ANXA1) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the ANXA1 anxa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS -MAMVSEFLK Q ACYIEKQEQE YVQAVKSYKG GPGSAVSPYP SFNPSSDVAA LHKAIMVKGV DEATIIDILT KRTNAQRQQI KAAYLQETGK PLDETLKKAL TGHLEEVVLA MLKTPAQFDA DELRAAMKGL GTDEDTLIEI LTTRSNQQIR EITRVYREEL KRDLAKDITS DTSGDFRNAL LALAKGDRCE DMSVNQDLAD TDARALYEAG ERRKGTDVNV FNTILTTRSY PHLRKVFQNY RKYSQHDMNK ALDLELKGDI EKCLTTIVKC ATSTPAFFAE KLYEAMKGAG TRHKTLIRIM VSRSEIDMNE IKVFYQKKYG IPLCQAILDE TKGDYEKILV ALCGGN. It is sometimes possible for the material contained within the vial of "Annexin A1 (ANXA1), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
