Mouse anti-Human CRYBA4 Monoclonal Antibody | anti-CRYBA4 antibody

CRYBA4 (Beta-crystallin A4, Beta-A4 Crystallin) (FITC)

Cat. Num. AAA6146672

• Gene Names: CRYBA4; CYRBA4; CTRCT23; MCOPCT4
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: CRYBA4; Monoclonal Antibody; CRYBA4 (Beta-crystallin A4; Beta-A4 Crystallin) (FITC); anti-CRYBA4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D7
• Specificity: Recognizes human CRYBA4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-CRYBA4 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa96-195 from human CRYBA4 (NP_001877) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PAACANHRDSRLTIFEQENFLGKKGELSDDYPSLQAMGWEGNEVGSFHVHSGAWVCSQFPGYRGFQYVLECDHHSGDYKHFREWGSHAPTFQVQSIRRIQ
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Testing Data

(Detection limit for recombinant GST tagged CRYBA4 is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-CRYBA4 antibody

Crystallins are the dominant structural components of the vertebrate eye lens.

Product Categories/Family for anti-CRYBA4 antibody

Antibodies; Crystallins

NCBI and Uniprot Product Information

• NCBI GI #: 4503059
• NCBI GeneID: 1413
• NCBI Accession #: NP_001877
• NCBI GenBank Nucleotide #: NM_001886
• UniProt Accession #: P53673; Q4VB22; Q6ICE4
• Molecular Weight: 24.5 kDa (216aa), confirmed by MALDI-TOF
• NCBI Official Full Name: beta-crystallin A4
• NCBI Official Synonym Full Names: crystallin beta A4
• NCBI Official Symbol: CRYBA4
• NCBI Official Synonym Symbols: CYRBA4; CTRCT23; MCOPCT4
• NCBI Protein Information: beta-crystallin A4
• UniProt Protein Name: Beta-crystallin A4
• Protein Family: Beta-crystallin
• UniProt Gene Name: CRYBA4
• UniProt Entry Name: CRBA4_HUMAN

NCBI Description

Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group, none in the acidic group). Beta-crystallins form aggregates of different sizes and are able to self-associate to form dimers or to form heterodimers with other beta-crystallins. This gene, a beta acidic group member, is part of a gene cluster with beta-B1, beta-B2, and beta-B3. [provided by RefSeq, Jul 2008]

Uniprot Description

CRYBA4: a major structural protein of the eye lens. A member of the beta/gamma-crystallin family.

Chromosomal Location of Human Ortholog: 22q12.1

Molecular Function: structural constituent of eye lens

Biological Process: camera-type eye development; visual perception

Disease: Cataract 23