Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ANGPTL4 rabbit polyclonal antibody. Western Blot analysis of ANGPTL4 expression in mouse liver.)

Rabbit anti-Human, Mouse ANGPTL4 Polyclonal Antibody | anti-ANGPTL4 antibody

ANGPTL4 (Angiopoietin-related Protein 4, Angiopoietin-like Protein 4, Hepatic Fibrinogen/Angiopoietin-related Protein, HFARP, ARP4, HFARP, PGAR, PP1158, PSEC0166, UNQ171/PRO197) (PE)

Gene Names
ANGPTL4; NL2; ARP4; FIAF; PGAR; HFARP; pp1158; ANGPTL2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ANGPTL4; Polyclonal Antibody; ANGPTL4 (Angiopoietin-related Protein 4; Angiopoietin-like Protein 4; Hepatic Fibrinogen/Angiopoietin-related Protein; HFARP; ARP4; PGAR; PP1158; PSEC0166; UNQ171/PRO197) (PE); anti-ANGPTL4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ANGPTL4. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ANGPTL4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ANGPTL4, aa1-406 (NP_647475.1).
Immunogen Sequence
MSGAPTAGAALMLCAATAVLLSAQGGPVQSKSPRFASWDEMNVLAHGLLQLGQGLREHAERTRSQLSALERRLSACGSACQGTEGSTDLPLAPESRVDPEVLHSLQTQLKAQNSRIQQLFHKVAQQQRHLEKQHLRIQHLQSQFGLLDHKHLDHEVAKPARRKRLPEMAQPVDPAHNVSRLHRLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSDGGWTVIQRRHDGSVDFNRPWEAYKAGFGDPHGEFWLGLEKVHSITGDRNSRLAVQLRDWDGNAELLQFSVHLGGEDTAYSLQLTAPVAGQLGATTVPPSGLSVPFSTWDQDHDLRRDKNCAKSLSGGWWFGTCSHSNLNGQYFRSIPQQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ANGPTL4 rabbit polyclonal antibody. Western Blot analysis of ANGPTL4 expression in mouse liver.)

Western Blot (WB) (ANGPTL4 rabbit polyclonal antibody. Western Blot analysis of ANGPTL4 expression in mouse liver.)

Western Blot (WB)

(ANGPTL4 rabbit polyclonal antibody. Western Blot analysis of ANGPTL4 expression in HeLa.)

Western Blot (WB) (ANGPTL4 rabbit polyclonal antibody. Western Blot analysis of ANGPTL4 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of ANGPTL4 expression in transfected 293T cell line by ANGPTL4 polyclonal antibody. Lane 1: ANGPTL4 transfected lysate (45.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ANGPTL4 expression in transfected 293T cell line by ANGPTL4 polyclonal antibody. Lane 1: ANGPTL4 transfected lysate (45.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ANGPTL4 antibody
Angiopoietin-like protein 4 (ANGPTL4), also known as PPAR angiopoietinrelated protein, fasting-induced adipose factor, or hepatic fibrinogen /angiopoietin-related protein (HFARP), is a secreted adipokine predominantly expressed in adipose tissue and liver. The experimental results show that ANGPTL4 is a blood-borne hormone directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. Serum levels of ANGPTL4 were decreased in patients with type 2 diabetes. In animal experiments, ANGPTL4 treatments might reduce hyperglycemia, and improve glucose tolerance by decreasing hepatic glucose production and enhancing insulin-mediated inhibition of gluconeogenesis. However, the molecular mechanisms underlying its metabolic actions remain elusive.
Product Categories/Family for anti-ANGPTL4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,214 Da
NCBI Official Full Name
angiopoietin-related protein 4 isoform a
NCBI Official Synonym Full Names
angiopoietin-like 4
NCBI Official Symbol
ANGPTL4
NCBI Official Synonym Symbols
NL2; ARP4; FIAF; PGAR; HFARP; pp1158; ANGPTL2
NCBI Protein Information
angiopoietin-related protein 4; angiopoietin-like protein 4; fasting-induced adipose factor; PPARG angiopoietin related protein; hepatic angiopoietin-related protein; hepatic fibrinogen/angiopoietin-related protein; peroxisome proliferator-activated recep
UniProt Protein Name
Angiopoietin-related protein 4
UniProt Gene Name
ANGPTL4
UniProt Synonym Gene Names
ARP4; HFARP; PGAR; HFARP
UniProt Entry Name
ANGL4_HUMAN

Uniprot Description

ANGPTL4: Protein with hypoxia-induced expression in endothelial cells. May act as a regulator of angiogenesis and modulate tumorigenesis. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. May exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation.

Protein type: Secreted, signal peptide; Secreted; Apoptosis; Extracellular matrix; Inhibitor

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: extracellular space; proteinaceous extracellular matrix; extracellular region

Molecular Function: enzyme inhibitor activity; protein binding

Biological Process: positive regulation of angiogenesis; response to hypoxia; negative regulation of lipoprotein lipase activity; angiogenesis; cellular lipid metabolic process; cell differentiation; protein homooligomerization; negative regulation of apoptosis

Disease: Plasma Triglyceride Level Quantitative Trait Locus

Similar Products

Product Notes

The ANGPTL4 angptl4 (Catalog #AAA6369835) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANGPTL4 (Angiopoietin-related Protein 4, Angiopoietin-like Protein 4, Hepatic Fibrinogen/Angiopoietin-related Protein, HFARP, ARP4, HFARP, PGAR, PP1158, PSEC0166, UNQ171/PRO197) (PE) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ANGPTL4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ANGPTL4 angptl4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANGPTL4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.