Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of ANGPTL4 using anti-ANGPTL4 antibody (MBS178637).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.lane 1: recombinant human ANGPTL4 protein 1ngAfter Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ANGPTL4 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ANGPTL4 at approximately 55KD. The expected band size for ANGPTL4 is at 44KD. )

Rabbit anti-Human ANGPTL4 Polyclonal Antibody | anti-ANGPTL4 antibody

Anti-ANGPTL4 Antibody

Gene Names
ANGPTL4; NL2; ARP4; FIAF; HARP; PGAR; HFARP; TGQTL; UNQ171; pp1158
Reactivity
Human
Applications
Western Blot, ELISA
Purity
Immunogen affinity purified.
Synonyms
ANGPTL4; Polyclonal Antibody; Anti-ANGPTL4 Antibody; Angiopoietin like 4; Angiopoietin related protein 4; Angiopoietinlike 4; angiopoietin-like 4; Angiopoietin-like 4; Angiopoietin-like protein 4; Angiopoietinrelated protein 4; ANGL4; angptl 4; ANGPTL2; ARP4; PGAR; HFARP; pp1158; PSEC0166; TGQTL; Q9BY76; anti-ANGPTL4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
368
Applicable Applications for anti-ANGPTL4 antibody
Western Blot (WB), ELISA (EIA)
Application Notes
Western Blot: 0.1-0.5ug/ml
ELISA: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ANGPTL4 (369-406aa QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS), different from the related mouse and rat sequences by seven amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of ANGPTL4 using anti-ANGPTL4 antibody (MBS178637).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.lane 1: recombinant human ANGPTL4 protein 1ngAfter Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ANGPTL4 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ANGPTL4 at approximately 55KD. The expected band size for ANGPTL4 is at 44KD. )

Western Blot (WB) (Figure 1. Western blot analysis of ANGPTL4 using anti-ANGPTL4 antibody (MBS178637).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours.lane 1: recombinant human ANGPTL4 protein 1ngAfter Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ANGPTL4 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ANGPTL4 at approximately 55KD. The expected band size for ANGPTL4 is at 44KD. )
Related Product Information for anti-ANGPTL4 antibody
Rabbit IgG polyclonal antibody for Angiopoietin-related protein 4(ANGPTL4) detection.
Background: Angiopoietin-related protein 4 (Angptl4) is a protein that in humans is encoded by the ANGPTL4 gene. This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. And this gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. By radiation hybrid analysis, Angptl4 gene is mapped to 19p13.3. ANGPTL4 contributed to tumor growth and protected cells from anoikis, a form of programmed cell death induced when contact-dependent cells detach from the surrounding tissue matrix.
References
1. Romeo, S., Pennacchio, L. A., Fu, Y., Boerwinkle, E., Tybjaerg-Hansen, A., Hobbs, H. H., Cohen, J. C.Population-based resequencing of ANGPTL4 uncovers variations that reduce triglycerides and increase HDL. Nature Genet. 39: 513-516, 2007.
2. Yoon, J. C., Chickering, T. W., Rosen, E. D., Dussault, B., Qin, Y., Soukas, A., Friedman, J. M., Holmes, W. E., Spiegelman, B. M.Peroxisome proliferator-activated receptor gamma target gene encoding a novel angiopoietin-related protein associated with adipose differentiation. Molec. Cell. Biol. 20: 5343-5349, 2000.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
26,853 Da
NCBI Official Full Name
angiopoietin-related protein 4 isoform b
NCBI Official Synonym Full Names
angiopoietin like 4
NCBI Official Symbol
ANGPTL4
NCBI Official Synonym Symbols
NL2; ARP4; FIAF; HARP; PGAR; HFARP; TGQTL; UNQ171; pp1158
NCBI Protein Information
angiopoietin-related protein 4
UniProt Protein Name
Angiopoietin-related protein 4
UniProt Gene Name
ANGPTL4
UniProt Synonym Gene Names
ARP4; HFARP; PGAR; HFARP

NCBI Description

This gene encodes a glycosylated, secreted protein containing a C-terminal fibrinogen domain. The encoded protein is induced by peroxisome proliferation activators and functions as a serum hormone that regulates glucose homeostasis, lipid metabolism, and insulin sensitivity. This protein can also act as an apoptosis survival factor for vascular endothelial cells and can prevent metastasis by inhibiting vascular growth and tumor cell invasion. The C-terminal domain may be proteolytically-cleaved from the full-length secreted protein. Decreased expression of this gene has been associated with type 2 diabetes. Alternative splicing results in multiple transcript variants. This gene was previously referred to as ANGPTL2 but has been renamed ANGPTL4. [provided by RefSeq, Sep 2013]

Uniprot Description

ANGPTL4: Protein with hypoxia-induced expression in endothelial cells. May act as a regulator of angiogenesis and modulate tumorigenesis. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. May exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation.

Protein type: Apoptosis; Extracellular matrix; Inhibitor; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: extracellular region; extracellular space

Molecular Function: enzyme inhibitor activity; identical protein binding; protein binding

Biological Process: negative regulation of apoptosis; negative regulation of lipoprotein lipase activity; positive regulation of angiogenesis

Disease: Plasma Triglyceride Level Quantitative Trait Locus

Research Articles on ANGPTL4

Similar Products

Product Notes

The ANGPTL4 angptl4 (Catalog #AAA178637) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ANGPTL4 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ANGPTL4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA (EIA). Western Blot: 0.1-0.5ug/ml ELISA: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the ANGPTL4 angptl4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ANGPTL4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.