Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ANGPT1Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse ANGPT1 Polyclonal Antibody | anti-ANGPT1 antibody

ANGPT1 Antibody-middlel region

Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ANGPT1; Polyclonal Antibody; ANGPT1 Antibody-middlel region; angiopoietin-1; Ang1; Ang-1; 1110046O21Rik; anti-ANGPT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
IFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGT
Applicable Applications for anti-ANGPT1 antibody
Western Blot (WB)
Protein Size
498 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse ANGPT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ANGPT1Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ANGPT1Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ANGPT1 antibody
Description of Target: This gene encodes a secreted glycoprotein that belongs to the angiopoietin family of vascular growth factors. The encoded protein is a ligand in the vascular tyrosine kinase signaling pathway and regulates the formation and stabilization of blood vessels. This protein also functions in striated muscles by promoting proliferation, migration and differentiation of skeletal myoblasts and plays an essential role in the vascular response to tissue injury. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
54kDa
UniProt Protein Name
Angiopoietin-1
Protein Family
UniProt Gene Name
Angpt1
UniProt Synonym Gene Names
Agpt; ANG-1
UniProt Entry Name
ANGP1_MOUSE

Uniprot Description

ANGPT1: Binds and activates TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation. Plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Required for normal angiogenesis and heart development during embryogenesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. Mediates blood vessel maturation/stability. Implicated in endothelial developmental processes later and distinct from that of VEGF. Appears to play a crucial role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme.

Protein type: Secreted; Secreted, signal peptide

Cellular Component: extracellular space; microvillus; plasma membrane; extracellular region; lipid raft

Molecular Function: receptor tyrosine kinase binding; vascular endothelial growth factor receptor binding; receptor binding

Biological Process: positive regulation of cell adhesion; transmembrane receptor protein tyrosine kinase activation (dimerization); multicellular organismal development; positive regulation of receptor internalization; negative regulation of protein import into nucleus; negative regulation of cell adhesion; positive regulation of vascular endothelial growth factor receptor signaling pathway; ovarian follicle development; positive chemotaxis; negative regulation of protein amino acid phosphorylation; cardiac muscle morphogensis; hemopoiesis; negative regulation of neuron apoptosis; angiogenesis; vasculogenesis; regulation of I-kappaB kinase/NF-kappaB cascade; cell differentiation; protein homooligomerization; Tie receptor signaling pathway; in utero embryonic development; positive regulation of blood vessel endothelial cell migration; positive regulation of peptidyl-serine phosphorylation; cell-substrate adhesion; negative regulation of cytokine secretion during immune response; positive regulation of phosphoinositide 3-kinase cascade; patterning of blood vessels; positive regulation of protein kinase B signaling cascade; positive regulation of peptidyl-tyrosine phosphorylation; heparin biosynthetic process; positive regulation of protein ubiquitination; regulation of protein binding; negative regulation of vascular permeability; regulation of tumor necrosis factor production; sprouting angiogenesis; regulation of satellite cell proliferation; transmembrane receptor protein tyrosine kinase signaling pathway; negative regulation of apoptosis; endoderm development

Similar Products

Product Notes

The ANGPT1 angpt1 (Catalog #AAA3249708) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANGPT1 Antibody-middlel region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ANGPT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ANGPT1 angpt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: IFAITSQRQY MLRIELMDWE GNRAYSQYDR FHIGNEKQNY RLYLKGHTGT. It is sometimes possible for the material contained within the vial of "ANGPT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.