Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ALPPL2 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Rabbit ALPG Polyclonal Antibody | anti-ALPG antibody

ALPG Antibody - N-terminal region

Gene Names
ALPG; GCAP; ALPPL; ALPPL2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
ALPG; Polyclonal Antibody; ALPG Antibody - N-terminal region; anti-ALPG antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQT
Sequence Length
532
Applicable Applications for anti-ALPG antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 77%; Guinea Pig: 77%; Horse: 79%; Human: 100%; Mouse: 82%; Pig: 79%; Rabbit: 77%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ALPPL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ALPPL2 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-ALPPL2 Antibody Titration: 2.5ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-ALPG antibody
This is a rabbit polyclonal antibody against ALPPL2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase.
Product Categories/Family for anti-ALPG antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
251
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
alkaline phosphatase, germ cell type preproprotein
NCBI Official Synonym Full Names
alkaline phosphatase, germ cell
NCBI Official Symbol
ALPG
NCBI Official Synonym Symbols
GCAP; ALPPL; ALPPL2
NCBI Protein Information
alkaline phosphatase, germ cell type
UniProt Protein Name
Alkaline phosphatase, placental-like
UniProt Gene Name
ALPPL2
UniProt Synonym Gene Names
ALPPL; GCAP; PLAP-like
UniProt Entry Name
PPBN_HUMAN

NCBI Description

There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase. [provided by RefSeq, Jul 2008]

Uniprot Description

ALPPL2: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The product of this gene is a membrane bound glycosylated enzyme, localized to testis, thymus and certain germ cell tumors, that is closely related to both the placental and intestinal forms of alkaline phosphatase. [provided by RefSeq, Jul 2008]

Protein type: Membrane protein, GPI anchor; EC 3.1.3.1; Phosphatase (non-protein); Cofactor and Vitamin Metabolism - folate biosynthesis

Chromosomal Location of Human Ortholog: 2q37

Cellular Component: plasma membrane

Molecular Function: alkaline phosphatase activity; metal ion binding

Biological Process: dephosphorylation

Research Articles on ALPG

Similar Products

Product Notes

The ALPG alppl2 (Catalog #AAA3206496) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALPG Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ALPG can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ALPG alppl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MQGPWVLLLL GLRLQLSLGI IPVEEENPDF WNRQAAEALG AAKKLQPAQT. It is sometimes possible for the material contained within the vial of "ALPG, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.