Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ALOX12BSample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse ALOX12B Polyclonal Antibody | anti-ALOX12B antibody

ALOX12B Antibody - C-terminal region

Gene Names
Alox12b; Aloxe2; e-LOX2; 12R-LOX
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
ALOX12B; Polyclonal Antibody; ALOX12B Antibody - C-terminal region; anti-ALOX12B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLTTLQTYMDTLPDVKTTCIVLLVLWTLCREPDDRRPLGHFPDIHFVEEG
Sequence Length
701
Applicable Applications for anti-ALOX12B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse ALOX12B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ALOX12BSample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ALOX12BSample Tissue: Mouse Testis lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ALOX12B antibody
This gene encodes an enzyme involved in the conversion of arachidonic acid to 12R-hydroxyeicosatetraenoic acid. Mutations in this gene can prevent the formation of the epidermal permeability barrier and cause an ichthyosiform phenotype.
Product Categories/Family for anti-ALOX12B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81 kDa
NCBI Official Full Name
arachidonate 12-lipoxygenase, 12R-type
NCBI Official Synonym Full Names
arachidonate 12-lipoxygenase, 12R type
NCBI Official Symbol
Alox12b
NCBI Official Synonym Symbols
Aloxe2; e-LOX2; 12R-LOX
NCBI Protein Information
arachidonate 12-lipoxygenase, 12R-type
UniProt Protein Name
Arachidonate 12-lipoxygenase, 12R-type
UniProt Gene Name
Alox12b
UniProt Synonym Gene Names
Aloxe2; 12R-LOX; 12R-lipoxygenase; e-LOX 2
UniProt Entry Name
LX12B_MOUSE

NCBI Description

This gene encodes an enzyme involved in the conversion of arachidonic acid to 12R-hydroxyeicosatetraenoic acid. Mutations in this gene can prevent the formation of the epidermal permeability barrier and cause an ichthyosiform phenotype. [provided by RefSeq, Sep 2015]

Uniprot Description

Function: Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators. Mainly converts arachidonic acid to (12R)-hydroperoxyeicosatetraenoic acid/(12R)-HPETE and minor stereoisomers. In the skin, acts upstream of ALOXE3 on the lineolate moiety of esterified omega-hydroxyacyl-sphingosine (EOS) ceramides to produce an epoxy-ketone derivative, a crucial step in the conjugation of omega-hydroxyceramide to membrane proteins. Therefore plays a crucial role in the synthesis of corneocytes lipid envelope and the establishment of the skin barrier to water loss. May also play a role in the regulation of the expression of airway mucins. Ref.3 Ref.4 Ref.5 Ref.6

Catalytic activity: Arachidonate + O2 = (5Z,8Z,10E,14Z)-(12R)-12-hydroperoxyicosa-5,8,10,14-tetraenoate. Ref.3

Cofactor: Binds 1 iron ion per subunit

By similarity.

Pathway: Lipid metabolism; hydroperoxy eicosatetraenoic acid biosynthesis. Ref.3 Ref.5Lipid metabolism; sphingolipid metabolism. Ref.3 Ref.5

Subcellular location: Cytoplasm

By similarity.

Tissue specificity: Expressed in skin epidermis and other stratified epithelia including tongue and forestomach. Low levels of expression are found in trachea, brain and lung. Not expressed in intestine, liver, kidney, adipose tissue, muscle or hematopoietic cells. Ref.1

Developmental stage: In the embryo, expression begins at day 15.5. Ref.2

Disruption phenotype: Mice die within 3 to 5 hours after birth due to defective skin barrier function loosing around 30% of body weight within 3 hours. Dehydration through the skin is increased 8 folds. The outside-in barrier acquisition is also affected, the skin remaining permeable at E18.5 while it is impermeable in wild-type mice. The stratum corneum is more tightly packed while other layers are unaffected. Processing of filaggrin/FG is aberrant and the skin displays structural abnormalities. The cornified envelope is more fragile and the ceramide composition of the epidermis is altered. Ref.4 Ref.6

Miscellaneous: Mummy, a recessive ethylnitrosurea-induced mutant has a nonsense mutation in the catalytic domain of Lox12b, resulting in truncation of the protein by 68 amino-acids. The affected mice are born with red, shiny skin that dessicates and appears scaly. They probably die of dehydration like mice with targeted disruption of the gene (Ref.5).

Sequence similarities: Belongs to the lipoxygenase family.Contains 1 lipoxygenase domain.Contains 1 PLAT domain.

Research Articles on ALOX12B

Similar Products

Product Notes

The ALOX12B alox12b (Catalog #AAA3223749) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALOX12B Antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ALOX12B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ALOX12B alox12b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLTTLQTYMD TLPDVKTTCI VLLVLWTLCR EPDDRRPLGH FPDIHFVEEG. It is sometimes possible for the material contained within the vial of "ALOX12B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.