Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ALDOC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

Rabbit ALDOC Polyclonal Antibody | anti-ALDOC antibody

ALDOC antibody - C-terminal region

Gene Names
ALDOC; ALDC
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ALDOC; Polyclonal Antibody; ALDOC antibody - C-terminal region; anti-ALDOC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA
Sequence Length
364
Applicable Applications for anti-ALDOC antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 92%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ALDOC
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ALDOC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)

Western Blot (WB) (WB Suggested Anti-ALDOC Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)
Related Product Information for anti-ALDOC antibody
This is a rabbit polyclonal antibody against ALDOC. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.
Product Categories/Family for anti-ALDOC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
230
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
fructose-bisphosphate aldolase C
NCBI Official Synonym Full Names
aldolase, fructose-bisphosphate C
NCBI Official Symbol
ALDOC
NCBI Official Synonym Symbols
ALDC
NCBI Protein Information
fructose-bisphosphate aldolase C
UniProt Protein Name
Fructose-bisphosphate aldolase C
UniProt Gene Name
ALDOC
UniProt Synonym Gene Names
ALDC
UniProt Entry Name
ALDOC_HUMAN

NCBI Description

This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively. [provided by RefSeq, Jul 2008]

Uniprot Description

ALDOC: a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively. [provided by RefSeq, Jul 2008]

Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; Carbohydrate Metabolism - pentose phosphate pathway; Lyase; Carbohydrate Metabolism - fructose and mannose; EC 4.1.2.13

Chromosomal Location of Human Ortholog: 17cen-q12

Cellular Component: cytoskeleton; mitochondrion; axon; cytosol

Molecular Function: protein binding; cytoskeletal protein binding; fructose-bisphosphate aldolase activity

Biological Process: organ regeneration; glycolysis; apoptosis; glucose metabolic process; pathogenesis; response to organic nitrogen; response to organic cyclic substance; protein homotetramerization; gluconeogenesis; fructose 1,6-bisphosphate metabolic process; epithelial cell differentiation; carbohydrate metabolic process; response to hypoxia; protein heterotetramerization; aging; fructose metabolic process

Research Articles on ALDOC

Similar Products

Product Notes

The ALDOC aldoc (Catalog #AAA3208952) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALDOC antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ALDOC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ALDOC aldoc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CPLPRPWALT FSYGRALQAS ALNAWRGQRD NAGAATEEFI KRAEVNGLAA. It is sometimes possible for the material contained within the vial of "ALDOC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.