Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: AL1A3Sample Type: HCT116 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ALDH1A3 Polyclonal Antibody | anti-ALDH1A3 antibody

ALDH1A3 Antibody - N-terminal region

Gene Names
ALDH1A3; ALDH6; MCOP8; RALDH3; ALDH1A6
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ALDH1A3; Polyclonal Antibody; ALDH1A3 Antibody - N-terminal region; anti-ALDH1A3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFAT
Sequence Length
512
Applicable Applications for anti-ALDH1A3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human AL1A3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AL1A3Sample Type: HCT116 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: AL1A3Sample Type: HCT116 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ALDH1A3 antibody
This is a rabbit polyclonal antibody against AL1A3. It was validated on Western Blot

Target Description: This gene encodes an aldehyde dehydrogenase enzyme that uses retinal as a substrate. Mutations in this gene have been associated with microphthalmia, isolated 8, and expression changes have also been detected in tumor cells. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-ALDH1A3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
220
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
Aldehyde dehydrogenase family 1 member A3
NCBI Official Synonym Full Names
aldehyde dehydrogenase 1 family member A3
NCBI Official Symbol
ALDH1A3
NCBI Official Synonym Symbols
ALDH6; MCOP8; RALDH3; ALDH1A6
NCBI Protein Information
aldehyde dehydrogenase family 1 member A3
UniProt Protein Name
Aldehyde dehydrogenase family 1 member A3
UniProt Gene Name
ALDH1A3
UniProt Synonym Gene Names
ALDH6; RALDH-3; RalDH3
UniProt Entry Name
AL1A3_HUMAN

NCBI Description

This gene encodes an aldehyde dehydrogenase enzyme that uses retinal as a substrate. Mutations in this gene have been associated with microphthalmia, isolated 8, and expression changes have also been detected in tumor cells. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]

Uniprot Description

ALDH1A3: Recognizes as substrates free retinal and cellular retinol-binding protein-bound retinal. Seems to be the key enzyme in the formation of an RA gradient along the dorso-ventral axis during the early eye development and also in the development of the olfactory system. Belongs to the aldehyde dehydrogenase family.

Protein type: Oxidoreductase; Amino Acid Metabolism - histidine; Xenobiotic Metabolism - metabolism by cytochrome P450; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Xenobiotic Metabolism - drug metabolism - cytochrome P450; EC 1.2.1.5; Amino Acid Metabolism - tyrosine; Amino Acid Metabolism - phenylalanine

Chromosomal Location of Human Ortholog: 15q26.3

Cellular Component: cytoplasm; cytosol

Molecular Function: aldehyde dehydrogenase (NAD) activity; protein homodimerization activity; aldehyde dehydrogenase [NAD(P)+] activity; retinal dehydrogenase activity

Biological Process: inner ear morphogenesis; retinal metabolic process; righting reflex; embryonic eye morphogenesis; retinol metabolic process; positive regulation of apoptosis; olfactory pit development; retinoic acid metabolic process; optic cup morphogenesis involved in camera-type eye development; locomotory behavior; neuromuscular process controlling balance; nucleus accumbens development

Disease: Microphthalmia, Isolated 8

Research Articles on ALDH1A3

Similar Products

Product Notes

The ALDH1A3 aldh1a3 (Catalog #AAA3220161) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ALDH1A3 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ALDH1A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ALDH1A3 aldh1a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ATANGAVENG QPDRKPPALP RPIRNLEVKF TKIFINNEWH ESKSGKKFAT. It is sometimes possible for the material contained within the vial of "ALDH1A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.