Rabbit ALAD Polyclonal Antibody | anti-ALAD antibody

ALAD antibody - N-terminal region

Cat. Num. AAA3205958

• Gene Names: ALAD; PBGS; ALADH
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: ALAD; Polyclonal Antibody; ALAD antibody - N-terminal region; anti-ALAD antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: QPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLP
• Sequence Length: 339

• Applicable Applications for anti-ALAD antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 77%; Zebrafish: 83%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ALAD
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-ALAD antibodyFormalin Fixed Paraffin Embedded Tissue: Human AdrenalPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Immunohistochemistry (IHC)

(Rabbit Anti-ALAD antibodyFormalin Fixed Paraffin Embedded Tissue: Human KidneyPrimary antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20xExposure Time: 0.5-2.0sec)

Western Blot (WB)

(WB Suggested Anti-ALAD Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)

Related Product Information for anti-ALAD antibody

This is a rabbit polyclonal antibody against ALAD. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Product Categories/Family for anti-ALAD antibody

Polyclonal; Drugs and Drug Metabolism; Disease Related; Tissue Specific & Cell Marker

NCBI and Uniprot Product Information

• NCBI GI #: 189083849
• NCBI GeneID: 210
• NCBI Accession #: NP_000022
• NCBI GenBank Nucleotide #: NM_000031
• UniProt Accession #: P13716
• Molecular Weight: 37kDa
• NCBI Official Full Name: delta-aminolevulinic acid dehydratase isoform b
• NCBI Official Synonym Full Names: aminolevulinate dehydratase
• NCBI Official Symbol: ALAD
• NCBI Official Synonym Symbols: PBGS; ALADH
• NCBI Protein Information: delta-aminolevulinic acid dehydratase
• UniProt Protein Name: Delta-aminolevulinic acid dehydratase
• Protein Family: Aladin
• UniProt Gene Name: ALAD
• UniProt Synonym Gene Names: ALADH
• UniProt Entry Name: HEM2_HUMAN

NCBI Description

The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015]

Uniprot Description

ALAD: Catalyzes an early step in the biosynthesis of tetrapyrroles. Binds two molecules of 5-aminolevulinate per subunit, each at a distinct site, and catalyzes their condensation to form porphobilinogen. Defects in ALAD are the cause of acute hepatic porphyria (AHEPP). A form of porphyria. Porphyrias are inherited defects in the biosynthesis of heme, resulting in the accumulation and increased excretion of porphyrins or porphyrin precursors. They are classified as erythropoietic or hepatic, depending on whether the enzyme deficiency occurs in red blood cells or in the liver. AHP is characterized by attacks of gastrointestinal disturbances, abdominal colic, paralysis, and peripheral neuropathy. Most attacks are precipitated by drugs, alcohol, caloric deprivation, infections, or endocrine factors. Belongs to the ALADH family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 4.2.1.24; Cofactor and Vitamin Metabolism - porphyrin and chlorophyll; Lyase

Chromosomal Location of Human Ortholog: 9q33.1

Cellular Component: cytosol; nucleus

Molecular Function: identical protein binding; porphobilinogen synthase activity; zinc ion binding; lead ion binding; catalytic activity

Biological Process: porphyrin metabolic process; protoporphyrinogen IX biosynthetic process; protein homooligomerization; heme biosynthetic process

Disease: Porphyria, Acute Hepatic