Western Blot (WB)
(WB Suggested Anti-AKR7A3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)
Rabbit AKR7A3 Polyclonal Antibody | anti-AKR7A3 antibody
AKR7A3 antibody - middle region
Gene Names
AKR7A3; AFAR2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AKR7A3; Polyclonal Antibody; AKR7A3 antibody - middle region; anti-AKR7A3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKNGKQPVGRFFGNTW
Sequence Length
331
Applicable Applications for anti-AKR7A3 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 93%; Rat: 86%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AKR7A3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-AKR7A3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-AKR7A3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Transfected 293T)
Related Product Information for anti-AKR7A3 antibody
This is a rabbit polyclonal antibody against AKR7A3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-291 BM855386.1 13-303 292-719 BM920315.1 256-683 720-1015 BC031562.1 662-957 1016-1231 BG747063.1 249-464 1232-1241 AA844782.1 59-68 c 1242-1301 BC042420.1 1208-1267
Target Description: Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-291 BM855386.1 13-303 292-719 BM920315.1 256-683 720-1015 BC031562.1 662-957 1016-1231 BG747063.1 249-464 1232-1241 AA844782.1 59-68 c 1242-1301 BC042420.1 1208-1267
Product Categories/Family for anti-AKR7A3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
aflatoxin B1 aldehyde reductase member 3
NCBI Official Synonym Full Names
aldo-keto reductase family 7 member A3
NCBI Official Symbol
AKR7A3
NCBI Official Synonym Symbols
AFAR2
NCBI Protein Information
aflatoxin B1 aldehyde reductase member 3
UniProt Protein Name
Aflatoxin B1 aldehyde reductase member 3
Protein Family
UniProt Gene Name
AKR7A3
UniProt Synonym Gene Names
AFAR2; AFB1-AR 2
UniProt Entry Name
ARK73_HUMAN
NCBI Description
Aldo-keto reductases, such as AKR7A3, are involved in the detoxification of aldehydes and ketones.[supplied by OMIM, Apr 2004]
Uniprot Description
AKR7A3: Can reduce the dialdehyde protein-binding form of aflatoxin B1 (AFB1) to the non-binding AFB1 dialcohol. May be involved in protection of liver against the toxic and carcinogenic effects of AFB1, a potent hepatocarcinogen. Belongs to the aldo/keto reductase family. Aldo/keto reductase 2 subfamily.
Protein type: EC 1.-.-.-; Oxidoreductase
Chromosomal Location of Human Ortholog: 1p36.13
Cellular Component: cytosol
Molecular Function: electron carrier activity; aldo-keto reductase activity
Biological Process: xenobiotic metabolic process; aldehyde metabolic process
Research Articles on AKR7A3
Similar Products
Product Notes
The AKR7A3 akr7a3 (Catalog #AAA3211883) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AKR7A3 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's AKR7A3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AKR7A3 akr7a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VETELFPCLR HFGLRFYAFN PLAGGLLTGK YKYEDKNGKQ PVGRFFGNTW. It is sometimes possible for the material contained within the vial of "AKR7A3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
