Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (AK2 rabbit polyclonal antibody. Western Blot analysis of AK2 expression in human kidney.)

Rabbit anti-Human, Mouse AK2 Polyclonal Antibody | anti-AK2 antibody

AK2 (Adenylate Kinase Isoenzyme 2, AK 2, ATP-AMP Transphosphorylase 2, ADK2) (Biotin)

Gene Names
AK2; ADK2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
AK2; Polyclonal Antibody; AK2 (Adenylate Kinase Isoenzyme 2; AK 2; ATP-AMP Transphosphorylase 2; ADK2) (Biotin); anti-AK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human AK2. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-AK2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human AK2, aa1-239 (NP_001616.1).
Immunogen Sequence
MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(AK2 rabbit polyclonal antibody. Western Blot analysis of AK2 expression in human kidney.)

Western Blot (WB) (AK2 rabbit polyclonal antibody. Western Blot analysis of AK2 expression in human kidney.)

Western Blot (WB)

(AK2 rabbit polyclonal antibody. Western Blot analysis of AK2 expression in mouse kidney.)

Western Blot (WB) (AK2 rabbit polyclonal antibody. Western Blot analysis of AK2 expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of AK2 expression in transfected 293T cell line by AK2 polyclonal antibody. Lane 1: AK2 transfected lysate (26.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of AK2 expression in transfected 293T cell line by AK2 polyclonal antibody. Lane 1: AK2 transfected lysate (26.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AK2 antibody
Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Five isozymes of adenylate kinase have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis.
Product Categories/Family for anti-AK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
204
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
21,636 Da
NCBI Official Full Name
adenylate kinase 2, mitochondrial isoform a
NCBI Official Synonym Full Names
adenylate kinase 2
NCBI Official Symbol
AK2
NCBI Official Synonym Symbols
ADK2
NCBI Protein Information
adenylate kinase 2, mitochondrial

NCBI Description

Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2.[provided by RefSeq, Nov 2010]

Research Articles on AK2

Similar Products

Product Notes

The AK2 (Catalog #AAA6369211) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AK2 (Adenylate Kinase Isoenzyme 2, AK 2, ATP-AMP Transphosphorylase 2, ADK2) (Biotin) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's AK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the AK2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "AK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.