Rabbit anti-Mouse AIRE Polyclonal Antibody | anti-AIRE antibody

AIRE Antibody - N-terminal region

Cat. Num. AAA3223591

• Reactivity: Mouse
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: AIRE; Polyclonal Antibody; AIRE Antibody - N-terminal region; anti-AIRE antibody

• Host: Rabbit
• Reactivity: Mouse
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GDGMLRRLLRLHRTEIAVAIDSAFPLLHALADHDVVPEDKFQETLRLKEK
• Sequence Length: 492

• Applicable Applications for anti-AIRE antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse AIRE
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AIRESample Tissue: Mouse Liver lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-AIRE antibody

Transcription factor playing an essential role to promote self-tolerance in the thymus by regulating the expression of a wide array of self-antigens that have the commonality of being tissue-restricted in their expression pattern in the periphery, called tissue restricted antigens (TRA) (Probable). Binds to G-doublets in an A/T-rich environment; the preferred motif is a tandem repeat of 5'-. ATTGGTTA-3' combined with a 5'-TTATTA-3' box. Binds to nucleosomes (By similarity). Binds to chromatin and interacts selectively with histone H3 that is not methylated at 'Lys-4', not phosphorylated at 'Thr-3' and not methylated at 'Arg-2'. Functions as a sensor of histone H3 modifications that are important for the epigenetic regulation of gene expression. Mainly expressed by medullary thymic epithelial cells (mTECs), induces the expression of thousands of tissue-restricted proteins, which are presented on major histocompatibility complex class I (MHC-I) and MHC-II molecules to developing T-cells percolating through the thymic medulla (By similarity). Also induces self-tolerance through other mechanisms such as the regulation of the mTEC differentiation program. Controls the medullary accumulation of thymic dendritic cells and the development of regulatory T-cell through the regulation of XCL1 expression. Regulates the production of CCR4 and CCR7 ligands in medullary thymic epithelial cells and alters the coordinated maturation and migration of thymocytes. In thimic B-cells, allows the presentation of licensing-dependent endogenous self-anitgen for negative selection. In secondary lymphoid organs, induces functional inactivation of CD4+ T-cells. Expressed by a distinct bone marrow-derived population, induces self-tolerance through a mechanism that does not require regulatory T-cells and is resitant to innate inflammatory stimuli .

Product Categories/Family for anti-AIRE antibody

Polyclonal; Transcription Factor; Transcription Regulation; Lymphocyte Signaling; Growth Factors & Hormones; Immunology; DNA/RNA/Protein Interactions; Tissue Specific & Cell Marker

NCBI and Uniprot Product Information

• NCBI GI #: 409168278
• NCBI GeneID: 11634
• NCBI Accession #: NP_001258478.1
• NCBI GenBank Nucleotide #: NM_001271549.1
• UniProt Accession #: Q9Z0E3
• Molecular Weight: 54 kDa
• NCBI Official Full Name: autoimmune regulator isoform 2
• NCBI Official Synonym Full Names: autoimmune regulator (autoimmune polyendocrinopathy candidiasis ectodermal dystrophy)
• NCBI Official Symbol: Aire
• NCBI Protein Information: autoimmune regulator
• UniProt Protein Name: Autoimmune regulator
• Protein Family: Autoimmune regulator
• UniProt Gene Name: Aire
• UniProt Synonym Gene Names: APECED protein homolog

Uniprot Description

Transcription factor playing an essential role to promote self-tolerance in the thymus by regulating the expression of a wide array of self-antigens that have the commonality of being tissue-restricted in their expression pattern in the periphery, called tissue restricted antigens (TRA) (Probable). Binds to G-doublets in an A/T-rich environment; the preferred motif is a tandem repeat of 5'-. ATTGGTTA-3' combined with a 5'-TTATTA-3' box. Binds to nucleosomes (). Binds to chromatin and interacts selectively with histone H3 that is not methylated at 'Lys-4', not phosphorylated at 'Thr-3' and not methylated at 'Arg-2'. Functions as a sensor of histone H3 modifications that are important for the epigenetic regulation of gene expression. Mainly expressed by medullary thymic epithelial cells (mTECs), induces the expression of thousands of tissue-restricted proteins, which are presented on major histocompatibility complex class I (MHC-I) and MHC-II molecules to developing T-cells percolating through the thymic medulla (). Also induces self-tolerance through other mechanisms such as the regulation of the mTEC differentiation program (PubMed:19015306). Controls the medullary accumulation of thymic dendritic cells and the development of regulatory T-cell through the regulation of XCL1 expression (PubMed:21300913). Regulates the production of CCR4 and CCR7 ligands in medullary thymic epithelial cells and alters the coordinated maturation and migration of thymocytes (PubMed:19923453). In thimic B-cells, allows the presentation of licensing-dependent endogenous self-anitgen for negative selection (PubMed:26070482). In secondary lymphoid organs, induces functional inactivation of CD4+ T-cells. Expressed by a distinct bone marrow-derived population, induces self-tolerance through a mechanism that does not require regulatory T-cells and is resitant to innate inflammatory stimuli (PubMed:23993652).