Rabbit anti-Human, Mouse AIFM2 Polyclonal Antibody | anti-AIFM2 antibody

AIFM2 (Apoptosis-inducing Factor 2, Apoptosis-inducing Factor Homologous Mitochondrion-associated Inducer of Death, Apoptosis-inducing Factor-like Mitochondrion-associated Inducer of Death, p53-responsive Gene 3 Protein, AMID, PRG3, DKFZp686L1298, FLJ1449

Cat. Num. AAA6369167

• Gene Names: AIFM2; AMID; PRG3
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: AIFM2; Polyclonal Antibody; AIFM2 (Apoptosis-inducing Factor 2; Apoptosis-inducing Factor Homologous Mitochondrion-associated Inducer of Death; Apoptosis-inducing Factor-like Mitochondrion-associated Inducer of Death; p53-responsive Gene 3 Protein; AMID; PRG3; DKFZp686L1298; FLJ1449; anti-AIFM2 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human AIFM2. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-AIFM2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human AIFM2, aa1-373 (NP_116186.1).
• Immunogen Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVGQISGFYVGRLMVRLTKSRDLFVSTSWKTMRQSPP
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(AIFM2 rabbit polyclonal antibody. Western Blot analysis of AIFM2 expression in mouse lung.)

Western Blot (WB)

(Western Blot analysis of AIFM2 expression in transfected 293T cell line by AIFM2 polyclonal antibody. Lane 1: AIFM2 transfected lysate (40.5kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-AIFM2 antibody

The p53 tumor suppressor protein induces cell cycle arrest or apoptosis in response to cellular stresses. PRG3 (p53-responsive gene 3), is induced specifically under p53-dependent apoptotic conditions in human colon cancer cells. PRG3 has significant homology to bacterial oxidoreductases and the apoptosis-inducing factor, AIF. Unlike AIF, PRG3 localizes in the cytoplasm and its ectopic expression induces apoptosis. The PRG3 gene is thus a novel p53 target gene in a p53-dependent apoptosis pathway.

Product Categories/Family for anti-AIFM2 antibody

Antibodies; Apoptosis

NCBI and Uniprot Product Information

• NCBI GI #: 14318424
• NCBI GeneID: 84883
• NCBI Accession #: NP_116186.1
• NCBI GenBank Nucleotide #: NM_032797
• UniProt Accession #: Q9BRQ8; Q63Z39; B3KXI0
• Molecular Weight: 36,520 Da
• NCBI Official Full Name: apoptosis-inducing factor 2
• NCBI Official Synonym Full Names: apoptosis-inducing factor, mitochondrion-associated, 2
• NCBI Official Symbol: AIFM2
• NCBI Official Synonym Symbols: AMID; PRG3
• NCBI Protein Information: apoptosis-inducing factor 2; p53-responsive gene 3 protein; apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death; apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer of death
• UniProt Protein Name: Apoptosis-inducing factor 2
• Protein Family: Apoptosis-inducing factor
• UniProt Gene Name: AIFM2
• UniProt Synonym Gene Names: AMID; PRG3
• UniProt Entry Name: AIFM2_HUMAN

NCBI Description

This gene encodes a flavoprotein oxidoreductase that binds single stranded DNA and is thought to contribute to apoptosis in the presence of bacterial and viral DNA. The expression of this gene is also found to be induced by tumor suppressor protein p53 in colon cancer cells. [provided by RefSeq, Nov 2010]

Uniprot Description

AIFM2: Oxidoreductase, which may play a role in mediating a p53/TP53-dependent apoptosis response. Probable oxidoreductase that acts as a caspase-independent mitochondrial effector of apoptotic cell death. Binds to DNA in a sequence-independent manner. May contribute to genotoxin-induced growth arrest. Belongs to the FAD-dependent oxidoreductase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Oxidoreductase; Mitochondrial; Apoptosis; Membrane protein, integral; EC 1.-.-.-

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: extracellular space; mitochondrial outer membrane; mitochondrion; cytoplasm; integral to membrane; lipid particle; cytosol

Molecular Function: FAD binding; NADH dehydrogenase (ubiquinone) activity; DNA binding; electron-transferring-flavoprotein dehydrogenase activity

Biological Process: apoptotic mitochondrial changes; positive regulation of apoptosis