Western Blot (WB)
(Western Blot analysis of AIF1L expression in transfected 293T cell line by AIF1L polyclonal antibody. Lane 1: C9orf58 transfected lysate (16.5kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human AIF1L Polyclonal Antibody | anti-AIF1L antibody
AIF1L (Allograft Inflammatory Factor 1-like, Ionized Calcium-binding Adapter Molecule 2, C9orf58, IBA2, UNQ672/PRO1306, FLJ12783, MGC29466)
Gene Names
AIF1L; IBA2; C9orf58
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
AIF1L; Polyclonal Antibody; AIF1L (Allograft Inflammatory Factor 1-like; Ionized Calcium-binding Adapter Molecule 2; C9orf58; IBA2; UNQ672/PRO1306; FLJ12783; MGC29466); Anti -AIF1L (Allograft Inflammatory Factor 1-like; anti-AIF1L antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human C9orf58.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP
Applicable Applications for anti-AIF1L antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human C9orf58, aa1-150 (NP_113614).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of AIF1L expression in transfected 293T cell line by AIF1L polyclonal antibody. Lane 1: C9orf58 transfected lysate (16.5kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of AIF1L expression in transfected 293T cell line by AIF1L polyclonal antibody. Lane 1: C9orf58 transfected lysate (16.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-AIF1L antibody
Actin-binding protein that promotes actin bundling. May neither bind calcium nor depend on calcium for function.
Product Categories/Family for anti-AIF1L antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
17,068 Da
NCBI Official Full Name
AIF1L protein
NCBI Official Synonym Full Names
allograft inflammatory factor 1-like
NCBI Official Symbol
AIF1L
NCBI Official Synonym Symbols
IBA2; C9orf58
NCBI Protein Information
allograft inflammatory factor 1-like; ionized calcium binding adapter molecule 2; ionized calcium-binding adapter molecule 2
UniProt Protein Name
Allograft inflammatory factor 1-like
Protein Family
UniProt Gene Name
AIF1L
UniProt Synonym Gene Names
C9orf58; IBA2
UniProt Entry Name
AIF1L_HUMAN
Uniprot Description
IBA2: Actin-binding protein that promotes actin bundling. May neither bind calcium nor depend on calcium for function. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Calcium-binding
Chromosomal Location of Human Ortholog: 9q34.13-q34.3
Cellular Component: focal adhesion; cytoplasm; actin filament; actin cytoskeleton
Molecular Function: actin filament binding; calcium ion binding
Research Articles on AIF1L
Similar Products
Product Notes
The AIF1L aif1l (Catalog #AAA6006377) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The AIF1L (Allograft Inflammatory Factor 1-like, Ionized Calcium-binding Adapter Molecule 2, C9orf58, IBA2, UNQ672/PRO1306, FLJ12783, MGC29466) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AIF1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the AIF1L aif1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSGELSNRFQ GGKAFGLLKA RQERRLAEIN REFLCDQKYS DEENLPEKLT AFKEKYMEFD LNNEGEIDLM SLKRMMEKLG VPKTHLEMKK MISEVTGGVS DTISYRDFVN MMLGKRSAVL KLVMMFEGKA NESSPKPVGP PPERDIASLP. It is sometimes possible for the material contained within the vial of "AIF1L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
