AIF Polyclonal Antibody | anti-AIF antibody

Anti-AIF Antibody

Cat. Num. AAA178177

• Gene Names: AIFM1; AIF; CMT2D; CMTX4; COWCK; DFNX5; NADMR; NAMSD; PDCD8; COXPD6
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: AIF; Polyclonal Antibody; Anti-AIF Antibody; Apoptosis-inducing factor 1; AIFM1; AIFM1_HUMAN; Apoptosis inducing factor 1; mitochondrial; Apoptosis inducing factor; mitochondrion associated; 1; CMTX4; COXPD6; Harlequin; Hq; mAIF; MGC111425; MGC5706; Neuropathy; axonal motor-sensory; with deafness and mental retardation; neuropathy; axonal; motor-sensory with deafness and mental retardation (Cowchock syndrome); PDCD 8; PDCD8; Programmed cell death 8 (apoptosis inducing factor); Programmed cell death 8; Programmed cell death 8 isoform 1; Programmed cell death 8 isoform 2; Programmed cell death 8 isoform 3; Programmed cell death protein 8; Programmed cell death protein 8 mitochondrial; Programmed cell death protein 8 mitochondrial precursor; Striatal apoptosis inducing factor; apoptosis-inducing factor; mitochondrion-associated; anti-AIF antibody

• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 274

• Applicable Applications for anti-AIF antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin, Immunocytochemistry (ICC)
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml; Immunocytochemistry Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human AIF(582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- AIF Picoband antibody, MBS178177, Western blottingAll lanes: Anti AIF (MBS178177) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: Rat Brain Tissue Lysate at 50ugLane 3: Mouse Stomach Tissue Lysate at 50ugLane 4: Mouse Spleen Tissue Lysate at 50ugLane 5: HELA Whole Cell Lysate at 40ugLane 6: U87 Whole Cell Lysate at 40ugLane 7: PANC Whole Cell Lysate at 40ugPredicted bind size: 67KDObserved bind size: 85KD )

Immunohistochemistry (IHC)

(Anti- AIF Picoband antibody, MBS178177, IHC(P)IHC(P): Mouse Cardiac Muscle Tissue )

Immunohistochemistry (IHC)

(Anti- AIF Picoband antibody, MBS178177, IHC(P)IHC(P): Rat Cardiac Muscle Tissue )

Immunohistochemistry (IHC)

(Anti- AIF Picoband antibody, MBS178177, IHC(P)IHC(P): Human Intestinal Cancer Tissue )

Immunocytochemistry (ICC)

(Anti- AIF Picoband antibody, MBS178177, ICCICC: SMMC-7721 Cell )

Related Product Information for anti-AIF antibody

Description: Rabbit IgG polyclonal antibody for Apoptosis-inducing factor 1, mitochondrial(AIFM1) detection. Tested with WB, IHC-P, ICC in Human;Mouse;Rat.

Background: Apoptosis-inducing factor 1, mitochondrial, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene. AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10.

References

1. Ghezzi, D., Sevrioukova, I., Invernizzi, F., Lamperti, C., Mora, M., D'Adamo, P., Novara, F., Zuffardi, O., Uziel, G., Zeviani, M. Severe X-linked mitochondrial encephalomyopathy associated with a mutation in apoptosis-inducing factor. Am. J. Hum. Genet. 86: 639-649, 2010. 2. Rinaldi, C., Grunseich, C., Sevrioukova, I. F., Schindler, A., Horkayne-Szakaly, I., Lamperti, C., Landoure, G., Kennerson, M. L., Burnett, B. G., Bonnemann, C., Biesecker, L. G., Ghezzi, D., Zeviani, M., Fischbeck, K. H. Cowchock syndrome is associated with a mutation in apoptosis-inducing factor. Am. J. Hum. Genet. 91: 1095-1102, 2012. 3. Yu, S.-W., Andrabi, S. A., Wang, H., Kim, N. S., Poirier, G. G., Dawson, T. M., Dawson, V. L. Apoptosis-inducing factor mediates poly(ADP-ribose) (PAR) polymer-induced cell death. Proc. Nat. Acad. Sci. 103: 18314-18319, 2006.

NCBI and Uniprot Product Information

• NCBI GI #: 923424571
• NCBI GeneID: 9131
• NCBI Accession #: NP_001124318.2
• NCBI GenBank Nucleotide #: NM_001130846.3
• UniProt Accession #: O95831; Q1L6K4; Q1L6K6; Q2QKE4; Q5JUZ7; Q6I9X6; Q9Y3I3; Q9Y3I4; A4QPB4; B1ALN1; B2RB08; D3DTE9
• Molecular Weight: 26,033 Da
• NCBI Official Full Name: apoptosis-inducing factor 1, mitochondrial isoform AIFsh
• NCBI Official Synonym Full Names: apoptosis inducing factor, mitochondria associated 1
• NCBI Official Symbol: AIFM1
• NCBI Official Synonym Symbols: AIF; CMT2D; CMTX4; COWCK; DFNX5; NADMR; NAMSD; PDCD8; COXPD6
• NCBI Protein Information: apoptosis-inducing factor 1, mitochondrial
• UniProt Protein Name: Apoptosis-inducing factor 1, mitochondrial
• Protein Family: Putative apoptosis-inducing factor
• UniProt Gene Name: AIFM1
• UniProt Synonym Gene Names: AIF; PDCD8
• UniProt Entry Name: AIFM1_HUMAN

NCBI Description

This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6 (COXPD6), a severe mitochondrial encephalomyopathy, as well as Cowchock syndrome, also known as X-linked recessive Charcot-Marie-Tooth disease-4 (CMTX-4), a disorder resulting in neuropathy, and axonal and motor-sensory defects with deafness and mental retardation. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 10. [provided by RefSeq, Aug 2015]

Uniprot Description

PDCD8: Probable oxidoreductase that has a dual role in controlling cellular life and death; during apoptosis, it is translocated from the mitochondria to the nucleus to function as a proapoptotic factor in a caspase-independent pathway, while in normal mitochondria, it functions as an antiapoptotic factor via its oxidoreductase activity. The soluble form (AIFsol) found in the nucleus induces 'parthanatos' i.e., caspase-independent fragmentation of chromosomal DNA. Interacts with EIF3G,and thereby inhibits the EIF3 machinery and protein synthesis, and activates casapse-7 to amplify apoptosis. Plays a critical role in caspase- independent, pyknotic cell death in hydrogen peroxide-exposed cells. Binds to DNA in a sequence-independent manner. Interacts with XIAP/BIRC4. Interacts (via N-terminus) with EIF3G (via C-terminus). Belongs to the FAD-dependent oxidoreductase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Oxidoreductase; Mitochondrial; EC 1.-.-.-; Apoptosis

Chromosomal Location of Human Ortholog: Xq26.1

Cellular Component: cytosol; mitochondrial inner membrane; mitochondrial intermembrane space; mitochondrion; nucleus; perinuclear region of cytoplasm

Molecular Function: DNA binding; electron carrier activity; NAD(P)H oxidase activity; oxidoreductase activity, acting on NADH or NADPH; protein binding; protein dimerization activity

Biological Process: apoptosis; caspase activation; cell redox homeostasis; chromosome condensation; DNA catabolic process; mitochondrial respiratory chain complex I assembly; neuron apoptosis; neuron differentiation; positive regulation of apoptosis; positive regulation of neuron apoptosis; response to toxin

Disease: Cowchock Syndrome