Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Immunohistochemistry with Formalin-Fixed, Paraffin-Embedded (FFPE) human tonsil tissue at an antibody concentration of 10 ug/ml using anti-AICDA Antibody )

Rabbit AICDA Polyclonal Antibody | anti-AICDA antibody

AICDA Antibody N-terminal region

Gene Names
AICDA; AID; ARP2; CDA2; HIGM2; HEL-S-284
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Purity
Affinity Purified
Synonyms
AICDA; Polyclonal Antibody; AICDA Antibody N-terminal region; anti-AICDA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
Sequence Length
198
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry with Formalin-Fixed, Paraffin-Embedded (FFPE) human tonsil tissue at an antibody concentration of 10 ug/ml using anti-AICDA Antibody )

Immunohistochemistry (IHC) (Immunohistochemistry with Formalin-Fixed, Paraffin-Embedded (FFPE) human tonsil tissue at an antibody concentration of 10 ug/ml using anti-AICDA Antibody )
Related Product Information for anti-AICDA antibody
activation-induced cytidine deaminase

Target Description: This gene encodes a RNA-editing deaminase that is a member of the cytidine deaminase family. The protein is involved in somatic hypermutation, gene conversion, and class-switch recombination of immunoglobulin genes. Defects in this gene are the cause of autosomal recessive hyper-IgM immunodeficiency syndrome type 2 (HIGM2).
Product Categories/Family for anti-AICDA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24 kDa
NCBI Official Full Name
single-stranded DNA cytosine deaminase isoform 1
NCBI Official Synonym Full Names
activation induced cytidine deaminase
NCBI Official Symbol
AICDA
NCBI Official Synonym Symbols
AID; ARP2; CDA2; HIGM2; HEL-S-284
NCBI Protein Information
single-stranded DNA cytosine deaminase
UniProt Protein Name
Single-stranded DNA cytosine deaminase
UniProt Gene Name
AICDA
UniProt Synonym Gene Names
AID
UniProt Entry Name
AICDA_HUMAN

NCBI Description

This gene encodes a RNA-editing deaminase that is a member of the cytidine deaminase family. The protein is involved in somatic hypermutation, gene conversion, and class-switch recombination of immunoglobulin genes. Defects in this gene are the cause of autosomal recessive hyper-IgM immunodeficiency syndrome type 2 (HIGM2). [provided by RefSeq, Feb 2009]

Uniprot Description

AID: Single-stranded DNA-specific cytidine deaminase. Involved in somatic hypermutation, gene conversion, and class- switch recombination in B-lymphocytes. Required for several crucial steps of B-cell terminal differentiation necessary for efficient antibody responses. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation. Strongly expressed in lymph nodes and tonsils. Belongs to the cytidine and deoxycytidylate deaminase family.

Protein type: EC 3.5.4.38; Hydrolase

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: cytoplasm; exosome (RNase complex); nucleus

Molecular Function: protein binding; zinc ion binding; ubiquitin protein ligase binding; cytidine deaminase activity

Biological Process: somatic diversification of immunoglobulins; B cell differentiation; somatic hypermutation of immunoglobulin genes; isotype switching; cytidine deamination; mRNA processing

Disease: Immunodeficiency With Hyper-igm, Type 2

Research Articles on AICDA

Similar Products

Product Notes

The AICDA aicda (Catalog #AAA3215941) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AICDA Antibody N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: VKRRDSATSF SLDFGYLRNK NGCHVELLFL RYISDWDLDP GRCYRVTWFT. It is sometimes possible for the material contained within the vial of "AICDA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.