Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using AGTPBP1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)

Rabbit anti-Human, Mouse AGTPBP1 Polyclonal Antibody | anti-AGTPBP1 antibody

AGTPBP1 Polyclonal Antibody

Gene Names
AGTPBP1; CCP1; NNA1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
AGTPBP1; Polyclonal Antibody; AGTPBP1 Polyclonal Antibody; CCP1; NNA1; anti-AGTPBP1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
PPEVDDVVDESDDNDDIDVEAENETENEDDLDQNFKNDDIETDINKLKPQQEPGRTIEDLKMYEHLFPELVDDFQDYDLISKEPKPFVFEGKVRGPIVVPTAGEETSGNSGNLRKVVMKENISSKGDEGEKKSTFMDLAKEDIKDNDRTLQQQPGDQNRTISSVHGLNNDIVKALDRITLQNIPSQTAPGFTAEMKKDCSL
Sequence Length
1278
Applicable Applications for anti-AGTPBP1 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human AGTPBP1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm, Mitochondrion, Nucleus, cytosol
Positive Samples
U-87MG, Jurkat, 293T, A-549, Mouse pancreas, Rat testis
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using AGTPBP1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using AGTPBP1 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)
Product Categories/Family for anti-AGTPBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 133kDa; 138kDa
Observed: 138kDa
NCBI Official Full Name
cytosolic carboxypeptidase 1 isoform a
NCBI Official Synonym Full Names
ATP/GTP binding protein 1
NCBI Official Symbol
AGTPBP1
NCBI Official Synonym Symbols
CCP1; NNA1
NCBI Protein Information
cytosolic carboxypeptidase 1
UniProt Protein Name
Cytosolic carboxypeptidase 1
UniProt Gene Name
AGTPBP1
UniProt Synonym Gene Names
CCP1; KIAA1035; NNA1

NCBI Description

NNA1 is a zinc carboxypeptidase that contains nuclear localization signals and an ATP/GTP-binding motif that was initially cloned from regenerating spinal cord neurons of the mouse.[supplied by OMIM, Jul 2002]

Uniprot Description

Metallocarboxypeptidase that mediates deglutamylation of target proteins. Catalyzes the deglutamylation of polyglutamate side chains generated by post-translational polyglutamylation in proteins such as tubulins. Also removes gene-encoded polyglutamates from the carboxy-terminus of target proteins such as MYLK. Acts as a long-chain deglutamylase and specifically shortens long polyglutamate chains, while it is not able to remove the branching point glutamate, a process catalyzed by AGBL5/CCP5.

Research Articles on AGTPBP1

Similar Products

Product Notes

The AGTPBP1 agtpbp1 (Catalog #AAA9133130) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGTPBP1 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's AGTPBP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the AGTPBP1 agtpbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PPEVDDVVDE SDDNDDIDVE AENETENEDD LDQNFKNDDI ETDINKLKPQ QEPGRTIEDL KMYEHLFPEL VDDFQDYDLI SKEPKPFVFE GKVRGPIVVP TAGEETSGNS GNLRKVVMKE NISSKGDEGE KKSTFMDLAK EDIKDNDRTL QQQPGDQNRT ISSVHGLNND IVKALDRITL QNIPSQTAPG FTAEMKKDCS L. It is sometimes possible for the material contained within the vial of "AGTPBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.