Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Colon)

Rabbit AGR2 Polyclonal Antibody | anti-AGR2 antibody

AGR2 antibody - middle region

Gene Names
AGR2; AG2; AG-2; HPC8; GOB-4; HAG-2; XAG-2; PDIA17; HEL-S-116
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
AGR2; Polyclonal Antibody; AGR2 antibody - middle region; anti-AGR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLY
Sequence Length
175
Applicable Applications for anti-AGR2 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AGR2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Colon)

Immunohistochemistry (IHC) (Colon)

Western Blot (WB)

(Host: RabbitTarget Name: AGR2Sample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: AGR2Sample Tissue: Human MCF7Antibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: AGR2Sample Type: Fetal MuscleLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/laneGel Concentration: 0.12%)

Western Blot (WB) (Host: RabbitTarget Name: AGR2Sample Type: Fetal MuscleLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/laneGel Concentration: 0.12%)
Related Product Information for anti-AGR2 antibody
This is a rabbit polyclonal antibody against AGR2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: AGR2 and hAG-3, human homologues of genes involved in differentiation, are associated with oestrogen receptor-positive breast tumours and interact with metastasis gene C4.4a and dystroglycan. Increased AGR2 expression is a valuable prognostic factor to predict the clinical outcome of the prostate cancer patients.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
anterior gradient protein 2 homolog
NCBI Official Synonym Full Names
anterior gradient 2, protein disulphide isomerase family member
NCBI Official Symbol
AGR2
NCBI Official Synonym Symbols
AG2; AG-2; HPC8; GOB-4; HAG-2; XAG-2; PDIA17; HEL-S-116
NCBI Protein Information
anterior gradient protein 2 homolog
UniProt Protein Name
Anterior gradient protein 2 homolog
Protein Family
UniProt Gene Name
AGR2
UniProt Synonym Gene Names
AG2; AG-2; hAG-2
UniProt Entry Name
AGR2_HUMAN

NCBI Description

This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression. [provided by RefSeq, Mar 2017]

Research Articles on AGR2

Similar Products

Product Notes

The AGR2 agr2 (Catalog #AAA3206291) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AGR2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's AGR2 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the AGR2 agr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEQFVLLNLV YETTDKHLSP DGQYVPRIMF VDPSLTVRAD ITGRYSNRLY. It is sometimes possible for the material contained within the vial of "AGR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.