Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: AFPSample Type: Fetal Brain lysatesAntibody Dilution: 3.0ug/ml)

Rabbit AFP Polyclonal Antibody | anti-AFP antibody

AFP Antibody - C-terminal region

Gene Names
AFP; AFPD; FETA; HPAFP
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Synonyms
AFP; Polyclonal Antibody; AFP Antibody - C-terminal region; anti-AFP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KPQITEEQLEAVIADFSGLLEKCCQGQEQEVCFAEEGQKLISKTRAALGV
Sequence Length
609
Applicable Applications for anti-AFP antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 91%; Pig: 91%; Rat: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human AFP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: AFPSample Type: Fetal Brain lysatesAntibody Dilution: 3.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: AFPSample Type: Fetal Brain lysatesAntibody Dilution: 3.0ug/ml)
Related Product Information for anti-AFP antibody
This is a rabbit polyclonal antibody against AFP. It was validated on Western Blot

Target Description: This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly.
Product Categories/Family for anti-AFP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
174
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
alpha-fetoprotein isoform 1
NCBI Official Synonym Full Names
alpha fetoprotein
NCBI Official Symbol
AFP
NCBI Official Synonym Symbols
AFPD; FETA; HPAFP
NCBI Protein Information
alpha-fetoprotein
UniProt Protein Name
Alpha-fetoprotein
Protein Family
AFP
UniProt Gene Name
AFP
UniProt Synonym Gene Names
HPAFP
UniProt Entry Name
FETA_HUMAN

NCBI Description

This gene encodes alpha-fetoprotein, a major plasma protein produced by the yolk sac and the liver during fetal life. Alpha-fetoprotein expression in adults is often associated with hepatoma or teratoma. However, hereditary persistance of alpha-fetoprotein may also be found in individuals with no obvious pathology. The protein is thought to be the fetal counterpart of serum albumin, and the alpha-fetoprotein and albumin genes are present in tandem in the same transcriptional orientation on chromosome 4. Alpha-fetoprotein is found in monomeric as well as dimeric and trimeric forms, and binds copper, nickel, fatty acids and bilirubin. The level of alpha-fetoprotein in amniotic fluid is used to measure renal loss of protein to screen for spina bifida and anencephaly. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Binds copper, nickel, and fatty acids as well as, and bilirubin less well than, serum albumin. Only a small percentage (less than 2%) of the human AFP shows estrogen-binding properties.

Subunit structure: Dimeric and trimeric forms have been found in addition to the monomeric form.

Subcellular location: Secreted.

Tissue specificity: Plasma. Synthesized by the fetal liver and yolk sac.

Developmental stage: Occurs in the plasma of fetuses more than 4 weeks old, reaches the highest levels during the 12th-16th week of gestation, and drops to trace amounts after birth. The serum level in adults is usually less than 40 ng/ml. AFP occurs also at high levels in the plasma and ascitic fluid of adults with hepatoma.

Post-translational modification: Independent studies suggest heterogeneity of the N-terminal sequence of the mature protein and of the cleavage site of the signal sequence.Sulfated.

Sequence similarities: Belongs to the ALB/AFP/VDB family.Contains 3 albumin domains.

Research Articles on AFP

Similar Products

Product Notes

The AFP afp (Catalog #AAA3200223) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AFP Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's AFP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the AFP afp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KPQITEEQLE AVIADFSGLL EKCCQGQEQE VCFAEEGQKL ISKTRAALGV. It is sometimes possible for the material contained within the vial of "AFP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.