Western Blot (WB)
(Host: RabbitTarget Name: ADRB3Sample Tissue: Mouse Brain lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse ADRB3 Polyclonal Antibody | anti-ADRB3 antibody
ADRB3 Antibody - C-terminal region
Gene Names
Adrb3; Adrb-3; beta 3-AR
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
ADRB3; Polyclonal Antibody; ADRB3 Antibody - C-terminal region; anti-ADRB3 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RSPDFRDAFRRLLCSYGGRGPEEPRAVTFPASPVEARQSPPLNRFDGYEG
Sequence Length
400
Applicable Applications for anti-ADRB3 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of mouse ADRB3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: ADRB3Sample Tissue: Mouse Brain lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: ADRB3Sample Tissue: Mouse Brain lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ADRB3 antibody
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. Beta-3 is involved in the regulation of lipolysis and thermogenesis.
Product Categories/Family for anti-ADRB3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44 kDa
NCBI Official Full Name
beta-3 adrenergic receptor
NCBI Official Synonym Full Names
adrenergic receptor, beta 3
NCBI Official Symbol
Adrb3
NCBI Official Synonym Symbols
Adrb-3; beta 3-AR
NCBI Protein Information
beta-3 adrenergic receptor
UniProt Protein Name
Beta-3 adrenergic receptor
Protein Family
UniProt Gene Name
Adrb3
UniProt Synonym Gene Names
Adrb3r; B3bar; Beta-3 adrenoceptor
Uniprot Description
Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. Beta-3 is involved in the regulation of lipolysis and thermogenesis.
Research Articles on ADRB3
1. In contrast, Adrb3 activation stimulates mature white adipocytes to convert into beige adipocytes.
Similar Products
Product Notes
The ADRB3 adrb3 (Catalog #AAA3224236) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADRB3 Antibody - C-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ADRB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADRB3 adrb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RSPDFRDAFR RLLCSYGGRG PEEPRAVTFP ASPVEARQSP PLNRFDGYEG. It is sometimes possible for the material contained within the vial of "ADRB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
