Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ADORA2A rabbit polyclonal antibody. Western Blot analysis of ADORA2A expression in human pancreas.)

Rabbit anti-Human, Mouse ADORA2A Polyclonal Antibody | anti-ADORA2A antibody

ADORA2A (Adenosine Receptor A2a, ADORA2) APC

Gene Names
ADORA2A; A2aR; RDC8; ADORA2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ADORA2A; Polyclonal Antibody; ADORA2A (Adenosine Receptor A2a; ADORA2) APC; anti-ADORA2A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ADORA2A. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-ADORA2A antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ADORA2A, aa1-412 (NP_000666.2).
Immunogen Sequence
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ADORA2A rabbit polyclonal antibody. Western Blot analysis of ADORA2A expression in human pancreas.)

Western Blot (WB) (ADORA2A rabbit polyclonal antibody. Western Blot analysis of ADORA2A expression in human pancreas.)

Western Blot (WB)

(ADORA2A rabbit polyclonal antibody. Western Blot analysis of ADORA2A expression in mouse liver.)

Western Blot (WB) (ADORA2A rabbit polyclonal antibody. Western Blot analysis of ADORA2A expression in mouse liver.)

Western Blot (WB)

(Western Blot analysis of ADORA2A expression in transfected 293T cell line by ADORA2A polyclonal antibody. Lane 1: ADORA2A transfected lysate (44.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ADORA2A expression in transfected 293T cell line by ADORA2A polyclonal antibody. Lane 1: ADORA2A transfected lysate (44.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ADORA2A antibody
The A2a Adenosine Receptor is a major target of caffeine. This receptor inhibits cell aggregation, induces vasodilation, and downregulates inflammation. The A2a receptor has been reported to be expressed in brain, embryo, heart, lung, and vessel. ESTs have been isolated from B-cell/lung/testis, blood, brain, colon, embryo, heart/melanocyte/uterus, kidney, liver/spleen, lung, skeletal muscle, testis, and tonsil libraries.
Product Categories/Family for anti-ADORA2A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
135
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,707 Da
NCBI Official Full Name
adenosine receptor A2a
NCBI Official Synonym Full Names
adenosine A2a receptor
NCBI Official Symbol
ADORA2A
NCBI Official Synonym Symbols
A2aR; RDC8; ADORA2
NCBI Protein Information
adenosine receptor A2a; adenosine receptor subtype A2a
UniProt Protein Name
Adenosine receptor A2a
Protein Family
UniProt Gene Name
ADORA2A
UniProt Synonym Gene Names
ADORA2
UniProt Entry Name
AA2AR_HUMAN

NCBI Description

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily, which is subdivided into classes and subtypes. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and activate intracellular signal transduction pathways. This protein, an adenosine receptor of A2A subtype, uses adenosine as the preferred endogenous agonist and preferentially interacts with the G(s) and G(olf) family of G proteins to increase intracellular cAMP levels. It plays an important role in many biological functions, such as cardiac rhythm and circulation, cerebral and renal blood flow, immune function, pain regulation, and sleep. It has been implicated in pathophysiological conditions such as inflammatory diseases and neurodegenerative disorders. Alternative splicing results in multiple transcript variants. A read-through transcript composed of the upstream SPECC1L (sperm antigen with calponin homology and coiled-coil domains 1-like) and ADORA2A (adenosine A2a receptor) gene sequence has been identified, but it is thought to be non-coding. [provided by RefSeq, Jun 2013]

Uniprot Description

ADORA2A: one of several receptor subtypes for adenosine. A G-protein coupled receptor. Activation is mediated by G proteins which activate adenylyl cyclase. Abundant in basal ganglia, vasculature and platelets and it is a major target of caffeine.

Protein type: Membrane protein, integral; Receptor, GPCR; GPCR, family 1; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 22q11.23

Cellular Component: membrane; integral to plasma membrane; plasma membrane

Molecular Function: identical protein binding; protein binding; enzyme binding; adenosine receptor activity, G-protein coupled

Biological Process: central nervous system development; nerve growth factor receptor signaling pathway; blood circulation; apoptosis; adenylate cyclase activation; phagocytosis; G-protein signaling, coupled to cAMP nucleotide second messenger; cell-cell signaling; sensory perception; cellular defense response; cAMP biosynthetic process; inflammatory response; blood coagulation; adenosine receptor signaling pathway; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on ADORA2A

Similar Products

Product Notes

The ADORA2A adora2a (Catalog #AAA6368935) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADORA2A (Adenosine Receptor A2a, ADORA2) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ADORA2A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADORA2A adora2a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADORA2A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.