Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ADIPOR2 expression in transfected 293T cell line by ADIPOR2 MaxPab polyclonal antibody.Lane 1: ADIPOR2 transfected lysate(43.90 KDa).Lane 2: Non-transfected lysate.)

Rabbit anti-Human ADIPOR2 Polyclonal Antibody | anti-ADIPOR2 antibody

ADIPOR2 (adiponectin Receptor 2, ACDCR2, FLJ21432, MGC4640, PAQR2) (FITC)

Gene Names
ADIPOR2; PAQR2; ACDCR2
Reactivity
Human
Applications
Western Blot
Purity
Purified
Synonyms
ADIPOR2; Polyclonal Antibody; ADIPOR2 (adiponectin Receptor 2; ACDCR2; FLJ21432; MGC4640; PAQR2) (FITC); adiponectin Receptor 2; PAQR2; anti-ADIPOR2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ADIPOR2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-ADIPOR2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ADIPOR2 (NP_078827.2, 1aa-386aa) full-length human protein.
Immunogen Sequence
MNEPTENRLGCSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCKVWEGRWRVIPHDVLPDWLKDNDFLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGCVFFLCLGIFYMFRPNISFVAPLQEKVVFGLFFLGAILCLSFSWLFHTVYCHSEGVSRLFSKLDYSGIALLIMGSFVPWLYYSFYCNPQPCFIYLIVICVLGIAAIIVSQWDMFATPQYRGVRAGVFLGLGLSGIIPTLHYVISEGFLKAATIGQIGWLMLMASLYITGAALYAARIPERFFPGKCDIWFHSHQLFHIFVVAGAFVHFHGVSNLQEFRFMIGGGCSEEDAL
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

Western Blot (WB)

(Western Blot analysis of ADIPOR2 expression in transfected 293T cell line by ADIPOR2 MaxPab polyclonal antibody.Lane 1: ADIPOR2 transfected lysate(43.90 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ADIPOR2 expression in transfected 293T cell line by ADIPOR2 MaxPab polyclonal antibody.Lane 1: ADIPOR2 transfected lysate(43.90 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-ADIPOR2 antibody
The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]).[supplied by OMIM]
Product Categories/Family for anti-ADIPOR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,884 Da
NCBI Official Full Name
adiponectin receptor protein 2
NCBI Official Synonym Full Names
adiponectin receptor 2
NCBI Official Symbol
ADIPOR2
NCBI Official Synonym Symbols
PAQR2; ACDCR2
NCBI Protein Information
adiponectin receptor protein 2; progestin and adipoQ receptor family member II
UniProt Protein Name
Adiponectin receptor protein 2
UniProt Gene Name
ADIPOR2
UniProt Synonym Gene Names
PAQR2
UniProt Entry Name
ADR2_HUMAN

NCBI Description

The adiponectin receptors, ADIPOR1 (MIM 607945) and ADIPOR2, serve as receptors for globular and full-length adiponectin (MIM 605441) and mediate increased AMPK (see MIM 602739) and PPAR-alpha (PPARA; MIM 170998) ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin (Yamauchi et al., 2003 [PubMed 12802337]).[supplied by OMIM, Mar 2008]

Uniprot Description

ADIPOR2: Receptor for globular and full-length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin. Has some intermediate-affinity receptor activity for both globular and full-length adiponectin. Belongs to the ADIPOR family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, misc.

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: integral to membrane; plasma membrane

Molecular Function: adiponectin binding; identical protein binding; hormone binding; protein heterodimerization activity; receptor activity

Biological Process: positive regulation of glucose import; hormone-mediated signaling; heart development; adiponectin-mediated signaling pathway; fatty acid oxidation; female pregnancy; negative regulation of cell growth; response to nutrient

Research Articles on ADIPOR2

Similar Products

Product Notes

The ADIPOR2 adipor2 (Catalog #AAA6450456) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADIPOR2 (adiponectin Receptor 2, ACDCR2, FLJ21432, MGC4640, PAQR2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADIPOR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADIPOR2 adipor2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADIPOR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.