Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ADH5Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ADH5 Polyclonal Antibody | anti-ADH5 antibody

ADH5 Antibody - N-terminal region

Gene Names
ADH5; FDH; ADHX; ADH-3; FALDH; GSNOR; GSH-FDH; HEL-S-60p
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADH5; Polyclonal Antibody; ADH5 Antibody - N-terminal region; anti-ADH5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LCQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAK
Sequence Length
374
Applicable Applications for anti-ADH5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ADH5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ADH5Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADH5Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ADH5 antibody
This is a rabbit polyclonal antibody against ADH5. It was validated on Western Blot

Target Description: This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene.
Product Categories/Family for anti-ADH5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
128
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
alcohol dehydrogenase class-3
NCBI Official Synonym Full Names
alcohol dehydrogenase 5 (class III), chi polypeptide
NCBI Official Symbol
ADH5
NCBI Official Synonym Symbols
FDH; ADHX; ADH-3; FALDH; GSNOR; GSH-FDH; HEL-S-60p
NCBI Protein Information
alcohol dehydrogenase class-3
UniProt Protein Name
Alcohol dehydrogenase class-3
Protein Family
UniProt Gene Name
ADH5
UniProt Synonym Gene Names
FALDH; FDH; GSH-FDH
UniProt Entry Name
ADHX_HUMAN

NCBI Description

This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

ADH5: Class-III ADH is remarkably ineffective in oxidizing ethanol, but it readily catalyzes the oxidation of long-chain primary alcohols and the oxidation of S-(hydroxymethyl) glutathione. Belongs to the zinc-containing alcohol dehydrogenase family. Class-III subfamily.

Protein type: Energy Metabolism - methane; Oxidoreductase; Xenobiotic Metabolism - metabolism by cytochrome P450; EC 1.1.1.1; Lipid Metabolism - fatty acid; Mitochondrial; Carbohydrate Metabolism - glycolysis and gluconeogenesis; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Amino Acid Metabolism - tyrosine; Cofactor and Vitamin Metabolism - retinol; EC 1.1.1.284

Chromosomal Location of Human Ortholog: 4q23

Cellular Component: mitochondrion; nucleus

Molecular Function: protein homodimerization activity; electron carrier activity; zinc ion binding; formaldehyde dehydrogenase activity; alcohol dehydrogenase activity; S-(hydroxymethyl)glutathione dehydrogenase activity; fatty acid binding

Biological Process: response to nitrosative stress; respiratory system process; ethanol catabolic process; formaldehyde catabolic process; peptidyl-cysteine S-nitrosylation; response to redox state; response to lipopolysaccharide; retinoid metabolic process; ethanol oxidation; positive regulation of blood pressure; aging

Research Articles on ADH5

Similar Products

Product Notes

The ADH5 adh5 (Catalog #AAA3219223) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADH5 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADH5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADH5 adh5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LCQKIRVTQG KGLMPDGTSR FTCKGKTILH YMGTSTFSEY TVVADISVAK. It is sometimes possible for the material contained within the vial of "ADH5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.