Rabbit Adenine Nucleotide Translocator 2 Polyclonal Antibody | anti-SLC25A5 antibody
Adenine Nucleotide Translocator 2 Antibody FITC-Conjugated
Dot Blot: 1:10,000
ELISA: 1:10,000
Immunocytochemistry: 1:100
Immunofluorescence: 1:100
Immunohistochemistry: 1:100
Immunoprecipitation: 1:200
Western Blot: 1:500
Sequence: AEREFRGLGDCLVKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAK
Catalyzes exchange of cytoplasmic ADP with mitochondrial ATP across mitochondrial inner membrane. May also play role in chromosome segregation.
NCBI and Uniprot Product Information
NCBI Description
This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the cytoplasm into the mitochondrial matrix and ATP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Suppressed expression of this gene has been shown to induce apoptosis and inhibit tumor growth. The human genome contains several non-transcribed pseudogenes of this gene.[provided by RefSeq, Jun 2013]
Uniprot Description
SLC25A5: Catalyzes the exchange of cytoplasmic ADP with mitochondrial ATP across the mitochondrial inner membrane. As part of the mitotic spindle-associated MMXD complex it may play a role in chromosome segregation. Belongs to the mitochondrial carrier family.
Protein type: Transporter, SLC family; Membrane protein, multi-pass; Mitochondrial; Membrane protein, integral; Transporter
Chromosomal Location of Human Ortholog: Xq24
Cellular Component: integral to plasma membrane; membrane; mitochondrial inner membrane; mitochondrion; myelin sheath; nucleus
Molecular Function: adenine transmembrane transporter activity; protein binding; structural constituent of ribosome; ubiquitin protein ligase binding
Biological Process: adenine transport; chromosome segregation; positive regulation of cell proliferation; regulation of insulin secretion; translation; transmembrane transport; transport; viral reproduction
Research Articles on SLC25A5
Similar Products
Product Notes
The SLC25A5 slc25a5 (Catalog #AAA540972) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Adenine Nucleotide Translocator 2 Antibody FITC-Conjugated reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Adenine Nucleotide Translocator 2 can be used in a range of immunoassay formats including, but not limited to, Confocal Microscopy (CM), ELISA (EIA), Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunoprecipitation (IP), Western Blot (WB). Confocal Microscopy||1:100 Dot Blot: 1:10,000 ELISA: 1:10,000 Immunocytochemistry: 1:100 Immunofluorescence: 1:100 Immunohistochemistry: 1:100 Immunoprecipitation: 1:200 Western Blot: 1:500. Researchers should empirically determine the suitability of the SLC25A5 slc25a5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Adenine Nucleotide Translocator 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.