Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ADAP2Sample Tissue: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ADAP2 Polyclonal Antibody | anti-ADAP2 antibody

ADAP2 Antibody - middle region

Gene Names
ADAP2; CENTA2; cent-b; HSA272195
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ADAP2; Polyclonal Antibody; ADAP2 Antibody - middle region; anti-ADAP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IRAKYERREFMADGETISLPGNREGFLWKRGRDNSQFLRRKFVLLAREGL
Sequence Length
381
Applicable Applications for anti-ADAP2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ADAP2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ADAP2Sample Tissue: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ADAP2Sample Tissue: ACHN Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-ADAP2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42 kDa
NCBI Official Full Name
arf-GAP with dual PH domain-containing protein 2 isoform 2
NCBI Official Synonym Full Names
ArfGAP with dual PH domains 2
NCBI Official Symbol
ADAP2
NCBI Official Synonym Symbols
CENTA2; cent-b; HSA272195
NCBI Protein Information
arf-GAP with dual PH domain-containing protein 2
UniProt Protein Name
Arf-GAP with dual PH domain-containing protein 2
UniProt Gene Name
ADAP2
UniProt Synonym Gene Names
CENTA2; Cnt-a2
UniProt Entry Name
ADAP2_HUMAN

NCBI Description

The protein encoded by this gene binds beta-tubulin and increases the stability of microtubules. The encoded protein can also translocate to the cell membrane and bind phosphatidylinositol 3,4,5-trisphosphate (PtdInsP3) and inositol 1,3,4,5-tetrakisphosphate (InsP4). In addition, this protein is a GTPase-activating protein for ADP ribosylation factor 6 and may be able to block the entry of some RNA viruses. [provided by RefSeq, Oct 2016]

Uniprot Description

CENTA2: GTPase-activating protein for the ADP ribosylation factor family (Potential). Binds phosphatidylinositol 3,4,5- trisphosphate (PtdInsP3) and inositol 1,3,4,5-tetrakisphosphate (InsP4). Possesses a stoichiometry of two binding sites for InsP4 with identical affinity. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GAPs, ARF; Lipid-binding; GAPs; Mitochondrial

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: mitochondrial envelope; cytoplasm; plasma membrane

Molecular Function: protein binding, bridging; protein binding; phosphatidylinositol-4,5-bisphosphate binding; phosphatidylinositol-3,4,5-triphosphate binding; inositol 1,3,4,5 tetrakisphosphate binding; zinc ion binding; phosphatidylinositol-3,4-bisphosphate binding

Biological Process: heart development; positive regulation of GTPase activity

Research Articles on ADAP2

Similar Products

Product Notes

The ADAP2 adap2 (Catalog #AAA3220973) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADAP2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADAP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADAP2 adap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IRAKYERREF MADGETISLP GNREGFLWKR GRDNSQFLRR KFVLLAREGL. It is sometimes possible for the material contained within the vial of "ADAP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.