Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of ADAM28 using anti-ADAM28 antibody (MBS178702).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: HELA whole cell lysates,lane 2: K562 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ADAM28 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ADAM28 at approximately 87/61KD. The expected band size for ADAM28 is at 87KD. )

Rabbit anti-Human ADAM28 Polyclonal Antibody | anti-ADAM28 antibody

Anti-ADAM28 Antibody

Gene Names
ADAM28; MDCL; MDC-L; eMDCII; ADAM 28; eMDC II
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
ADAM28; Polyclonal Antibody; Anti-ADAM28 Antibody; ADAM 28; ADAM23; eMDC II; eMDCII; MDC L; MDCL; Q9UKQ2; Disintegrin and metalloproteinase domain-containing protein 28; ADAM metallopeptidase domain 28; anti-ADAM28 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
754
Applicable Applications for anti-ADAM28 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM28 (207-248aa EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH), different from the related mouse sequence by eleven amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of ADAM28 using anti-ADAM28 antibody (MBS178702).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: HELA whole cell lysates,lane 2: K562 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ADAM28 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ADAM28 at approximately 87/61KD. The expected band size for ADAM28 is at 87KD. )

Western Blot (WB) (Figure 1. Western blot analysis of ADAM28 using anti-ADAM28 antibody (MBS178702).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: HELA whole cell lysates,lane 2: K562 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-ADAM28 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for ADAM28 at approximately 87/61KD. The expected band size for ADAM28 is at 87KD. )
Related Product Information for anti-ADAM28 antibody
Rabbit IgG polyclonal antibody for Disintegrin and metalloproteinase domain-containing protein 28(ADAM28) detection.
Background: Disintegrin and metalloproteinase domain-containing protein 28 is an enzyme that in humans is encoded by the ADAM28 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. And this gene is present in a gene cluster with other members of the ADAM family on chromosome 8. Alternative splicing results in multiple transcript variants.
References
1. "Entrez Gene: ADAM28 ADAM metallopeptidase domain 28".
2. Bridges LC, Hanson KR, Tani PH, et al. (2003). "Integrin alpha4beta1-dependent adhesion to ADAM 28 (MDC-L) requires an extended surface of the disintegrin domain". Biochemistry. 42 (13): 3734-41.
3. Howard L, Maciewicz RA, Blobel CP (2000). "Cloning and characterization of ADAM28: evidence for autocatalytic pro-domain removal and for cell surface localization of mature ADAM28". Biochem. J. 348 Pt 1 (Pt 1): 21-7.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,232 Da
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 28 isoform 4 preproprotein
NCBI Official Synonym Full Names
ADAM metallopeptidase domain 28
NCBI Official Symbol
ADAM28
NCBI Official Synonym Symbols
MDCL; MDC-L; eMDCII; ADAM 28; eMDC II
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 28
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 28
UniProt Gene Name
ADAM28
UniProt Synonym Gene Names
ADAM23; MDCL; ADAM 28; eMDC II; MDC-L

NCBI Description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. This gene is present in a gene cluster with other members of the ADAM family on chromosome 8. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]

Uniprot Description

ADAM28: May play a role in the adhesive and proteolytic events that occur during lymphocyte emigration or may function in ectodomain shedding of lymphocyte surface target proteins, such as FASL and CD40L. May be involved in sperm maturation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.24.-; Membrane protein, integral; Motility/polarity/chemotaxis; Protease

Chromosomal Location of Human Ortholog: 8p21.2

Molecular Function: metallopeptidase activity

Biological Process: spermatogenesis

Research Articles on ADAM28

Similar Products

Product Notes

The ADAM28 adam28 (Catalog #AAA178702) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ADAM28 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADAM28 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the ADAM28 adam28 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADAM28, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.