Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of ADAM2 expression in rat testis extract (lane 1), mouse testis extract (lane 2) and MCF-7 whole cell lysates (lane 3). ADAM2 at 100KD was detected using rabbit anti- ADAM2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit ADAM2 Polyclonal Antibody | anti-ADAM2 antibody

Anti-ADAM2 Antibody

Gene Names
ADAM2; CT15; FTNB; PH30; CRYN1; CRYN2; PH-30b; PH30-beta
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
ADAM2; Polyclonal Antibody; Anti-ADAM2 Antibody; CT15; Fertilin beta; Fertilin subunit beta; Ftnb; PH30; PH-30; Ph30 beta; PH30-beta; Q99965; Disintegrin and metalloproteinase domain-containing protein 2; ADAM metallopeptidase domain 2; anti-ADAM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
Rabbit IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
716
Applicable Applications for anti-ADAM2 antibody
Western Blot (WB)
Application Notes
Western Blot
Concentration:0.1-0.5ug/mL
Tested species: Hu, Ms, Rat

Tested species: In-house tested species with positive results.
Other applications have not been tested
Optimal dilutions should be determined by end users.
Reconstitution
0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ADAM2 (231-274aa WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK), different from the related mouse and rat sequences by eleven amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.
Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of ADAM2 expression in rat testis extract (lane 1), mouse testis extract (lane 2) and MCF-7 whole cell lysates (lane 3). ADAM2 at 100KD was detected using rabbit anti- ADAM2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of ADAM2 expression in rat testis extract (lane 1), mouse testis extract (lane 2) and MCF-7 whole cell lysates (lane 3). ADAM2 at 100KD was detected using rabbit anti- ADAM2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-ADAM2 antibody
Background: ADAM2 (A Disintegrin and Metalloproteinase Domain 2), also known as FTNB or PH30, is an enzyme that in humans is encoded by the ADAM2 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene is mapped to 8p11.2.
References
1. Burkin, H. R., Burkin, D. J., Davey, P. M., Griffin, D. K., Affara, N. A. Mapping, sequence, and expression analysis of the human fertilin beta gene (FTNB). Genomics 40: 190-192, 1997.
2. Gupta SK, Alves K, Palladino LO, Mark GE, Hollis GF (Aug 1996). "Molecular cloning of the human fertilin beta subunit". Biochem Biophys Res Commun 224 (2): 318-26.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80,158 Da
NCBI Official Full Name
disintegrin and metalloproteinase domain-containing protein 2 isoform 2
NCBI Official Synonym Full Names
ADAM metallopeptidase domain 2
NCBI Official Symbol
ADAM2
NCBI Official Synonym Symbols
CT15; FTNB; PH30; CRYN1; CRYN2; PH-30b; PH30-beta
NCBI Protein Information
disintegrin and metalloproteinase domain-containing protein 2
UniProt Protein Name
Disintegrin and metalloproteinase domain-containing protein 2
UniProt Gene Name
ADAM2
UniProt Synonym Gene Names
FTNB; ADAM 2; CT15; PH30

NCBI Description

This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The encoded protein is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]

Uniprot Description

ADAM2: a member of the ADAM (a disintegrin and metalloprotease domain) family of Cancer-Testis Antigen (CTAs) . CTAs may play roles in embryonal development and tumor transformation or aspects of tumor progression. CTAs were once thought to be silenced in most normal adult tissues, with limited expression in fetal, placental, testis, and ovary cells. These proteins are now known to be aberrantly expressed in various cancers and many are capable of eliciting humoral and cellular immune responses. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. A sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion during fertilization. Could have a direct role in sperm-zona binding or migration of sperm from the uterus into the oviduct. Interactions with egg membrane could be mediated via binding between its disintegrin-like domain to one or more integrins receptors on the egg. This is a non catalytic metalloprotease-like protein. Two isoforms of the human protein are produced by alternative splicing. Note: This description may include information from RefSeq and UniProtKB

Protein type: Cancer Testis Antigen (CTA); Cell surface; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 8p11.22

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function: integrin binding; metallopeptidase activity

Biological Process: binding of sperm to zona pellucida; fusion of sperm to egg plasma membrane

Research Articles on ADAM2

Similar Products

Product Notes

The ADAM2 adam2 (Catalog #AAA178707) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ADAM2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADAM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration:0.1-0.5ug/mL Tested species: Hu, Ms, Rat Tested species: In-house tested species with positive results. Other applications have not been tested Optimal dilutions should be determined by end users. Researchers should empirically determine the suitability of the ADAM2 adam2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADAM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.