Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ADA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

Rabbit ADA Polyclonal Antibody | anti-ADA antibody

ADA antibody - N-terminal region

Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ADA; Polyclonal Antibody; ADA antibody - N-terminal region; anti-ADA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA
Sequence Length
363
Applicable Applications for anti-ADA antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ADA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ADA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)

Western Blot (WB) (WB Suggested Anti-ADA Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: NCI-H226 cell lysate)
Related Product Information for anti-ADA antibody
This is a rabbit polyclonal antibody against ADA. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ADA is an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
100
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
adenosine deaminase isoform 1
NCBI Official Synonym Full Names
adenosine deaminase
NCBI Official Symbol
ADA
NCBI Protein Information
adenosine deaminase
UniProt Protein Name
Adenosine deaminase
Protein Family
UniProt Gene Name
ADA
UniProt Synonym Gene Names
ADA1
UniProt Entry Name
ADA_HUMAN

NCBI Description

This gene encodes an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia. [provided by RefSeq, Jul 2008]

Uniprot Description

ADA: a enzyme that converts adenosine + H2O into inosine + NH3. Found in all tissues, occurs in large amounts in T-lymphocytes and, at the time of weaning, in gastrointestinal tissues. Genetic ADA deficiencies are a cause of autosomal recessive severe combined immuno-deficiency (SCID). Hereditary hemolytic anemia is caused by expression levels in erythrocytes 50-70 times greater than the norm.

Protein type: Nucleotide Metabolism - purine; EC 3.5.4.4; Hydrolase

Chromosomal Location of Human Ortholog: 20q13.12

Cellular Component: dendrite cytoplasm; extracellular space; cell surface; membrane; cell soma; lysosome; cytoplasm; plasma membrane; cytosol; cell junction; external side of plasma membrane

Molecular Function: adenosine deaminase activity; protein binding; zinc ion binding; purine nucleoside binding

Biological Process: negative regulation of circadian sleep/wake cycle, non-REM sleep; T cell activation; adenosine catabolic process; deoxyadenosine catabolic process; response to morphine; positive regulation of calcium-mediated signaling; purine salvage; histamine secretion; positive regulation of T cell differentiation in the thymus; purine ribonucleoside monophosphate biosynthetic process; response to vitamin E; regulation of cell-cell adhesion mediated by integrin; positive regulation of T cell receptor signaling pathway; negative regulation of mature B cell apoptosis; positive regulation of B cell proliferation; positive regulation of germinal center formation; hypoxanthine salvage; positive regulation of smooth muscle contraction; negative regulation of adenosine receptor signaling pathway; embryonic gut development; aging; placenta development; Peyer's patch development; response to drug; dATP catabolic process; nucleobase, nucleoside and nucleotide metabolic process; positive regulation of heart rate; liver development; negative regulation of leukocyte migration; purine base metabolic process; trophectodermal cell differentiation; purine nucleotide salvage; xanthine biosynthetic process; response to hydrogen peroxide; negative regulation of inflammatory response; response to hypoxia; inosine biosynthetic process; germinal center B cell differentiation; alveolus development; positive regulation of alpha-beta T cell differentiation

Disease: Severe Combined Immunodeficiency, Autosomal Recessive, T Cell-negative, B Cell-negative, Nk Cell-negative, Due To Adenosine Deaminase Deficiency

Research Articles on ADA

Similar Products

Product Notes

The ADA ada (Catalog #AAA3210413) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ADA antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ADA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ADA ada for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AIAGCREAIK RIAYEFVEMK AKEGVVYVEV RYSPHLLANS KVEPIPWNQA. It is sometimes possible for the material contained within the vial of "ADA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.