Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ACVRL1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Rabbit ACVRL1 Polyclonal Antibody | anti-ACVRL1 antibody

ACVRL1 antibody - N-terminal region

Gene Names
ACVRL1; HHT; ALK1; HHT2; ORW2; SKR3; ALK-1; TSR-I; ACVRLK1
Reactivity
Dog, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACVRL1; Polyclonal Antibody; ACVRL1 antibody - N-terminal region; anti-ACVRL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNH
Sequence Length
503
Applicable Applications for anti-ACVRL1 antibody
Western Blot (WB)
Homology
Dog: 100%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 93%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ACVRL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ACVRL1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-ACVRL1 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-ACVRL1 antibody
This is a rabbit polyclonal antibody against ACVRL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ACVRL1 is a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. ACVRL1, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
94
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
serine/threonine-protein kinase receptor R3
NCBI Official Synonym Full Names
activin A receptor like type 1
NCBI Official Symbol
ACVRL1
NCBI Official Synonym Symbols
HHT; ALK1; HHT2; ORW2; SKR3; ALK-1; TSR-I; ACVRLK1
NCBI Protein Information
serine/threonine-protein kinase receptor R3
UniProt Protein Name
Serine/threonine-protein kinase receptor R3
UniProt Gene Name
ACVRL1
UniProt Synonym Gene Names
ACVRLK1; ALK1; SKR3; ALK-1; TSR-I
UniProt Entry Name
ACVL1_HUMAN

NCBI Description

This gene encodes a type I cell-surface receptor for the TGF-beta superfamily of ligands. It shares with other type I receptors a high degree of similarity in serine-threonine kinase subdomains, a glycine- and serine-rich region (called the GS domain) preceding the kinase domain, and a short C-terminal tail. The encoded protein, sometimes termed ALK1, shares similar domain structures with other closely related ALK or activin receptor-like kinase proteins that form a subfamily of receptor serine/threonine kinases. Mutations in this gene are associated with hemorrhagic telangiectasia type 2, also known as Rendu-Osler-Weber syndrome 2. [provided by RefSeq, Jul 2008]

Uniprot Description

ALK1: a kinase of the STKR family. A type I cell-surface receptor for the TGF-beta superfamily of ligands including Activin A. Highly expressed in human placenta and lung. Deficiency causes hemorrhagic telangiectasia type 2 also known as Rendu-Osler-Weber syndrome 2.

Protein type: Membrane protein, integral; Kinase, protein; Protein kinase, Ser/Thr (receptor); EC 2.7.11.30; Protein kinase, TKL; TKL group; STKR family; Type1 subfamily

Chromosomal Location of Human Ortholog: 12q13.13

Cellular Component: cell surface; cell soma; integral to plasma membrane; dendrite

Molecular Function: transforming growth factor beta receptor activity; protein serine/threonine kinase activity; protein binding; activin receptor activity, type I; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I; metal ion binding; activin binding; SMAD binding; protein kinase binding; ATP binding; transmembrane receptor protein serine/threonine kinase activity; receptor signaling protein serine/threonine kinase activity

Biological Process: blood circulation; protein heterooligomerization; positive regulation of transcription, DNA-dependent; activin receptor signaling pathway; negative regulation of cell adhesion; signal transduction; regulation of blood vessel endothelial cell migration; protein amino acid phosphorylation; BMP signaling pathway; negative regulation of cell proliferation; positive regulation of endothelial cell differentiation; regulation of transcription, DNA-dependent; negative regulation of endothelial cell differentiation; transforming growth factor beta receptor signaling pathway; regulation of blood pressure; lymphangiogenesis; angiogenesis; negative regulation of cell migration; positive regulation of BMP signaling pathway; regulation of DNA replication; regulation of endothelial cell proliferation; in utero embryonic development; negative regulation of focal adhesion formation; negative regulation of blood vessel endothelial cell migration; blood vessel maturation; blood vessel endothelial cell proliferation during sprouting angiogenesis; positive regulation of angiogenesis; positive regulation of chondrocyte differentiation; negative regulation of endothelial cell proliferation; blood vessel remodeling; positive regulation of transcription from RNA polymerase II promoter; positive regulation of endothelial cell proliferation; negative regulation of cell growth; wound healing, spreading of epidermal cells

Disease: Telangiectasia, Hereditary Hemorrhagic, Type 2

Research Articles on ACVRL1

Similar Products

Product Notes

The ACVRL1 acvrl1 (Catalog #AAA3207255) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACVRL1 antibody - N-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ACVRL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACVRL1 acvrl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPHCKGPTCR GAWCTVVLVR EEGRHPQEHR GCGNLHRELC RGRPTEFVNH. It is sometimes possible for the material contained within the vial of "ACVRL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.