Rabbit anti-Mouse, Rat ACTL7B Polyclonal Antibody | anti-ACTL7B antibody

ACTL7B Polyclonal Antibody

Cat. Num. AAA9133194

• Gene Names: ACTL7B; Tact1
• Reactivity: Mouse, Rat
• Applications: Western Blot
• Purity: Affinity Purification
• Synonyms: ACTL7B; Polyclonal Antibody; ACTL7B Polyclonal Antibody; Tact1; anti-ACTL7B antibody

• Host: Rabbit
• Reactivity: Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity Purification
• Sequence: GHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAGHAFTDDHLHIIEHIKKKCCYAAFLPEEELGLVPEELRVDYELPDGKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPAVAAAPERKTSV
• Sequence Length: 415

• Applicable Applications for anti-ACTL7B antibody: Western Blot (WB)
• Application Notes: WB: 1:500 - 1:2000
• Immunogen: Recombinant protein of human ACTL7B
• Immunogen Species: Human
• Storage Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Cellular Location: Cytoplasm, cytoskeleton
• Positive Samples: Mouse liver, Rat liver
• Preparation and Storage: Store at -20 degree C. Avoid freeze / thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using ACTL7B antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.)

Related Product Information for anti-ACTL7B antibody

The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7B), and related gene, ACTL7A, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.

Product Categories/Family for anti-ACTL7B antibody

Polyclonal Antibodies

NCBI and Uniprot Product Information

• NCBI GI #: 5729722
• NCBI GeneID: 10880
• NCBI Accession #: NP_006677.1
• NCBI GenBank Nucleotide #: NM_006686.3
• UniProt Accession #: Q9Y614; Q5JSV1; B2R9Q2
• Molecular Weight: Calculated: 45kDa; Observed: 45kDa
• NCBI Official Full Name: actin-like protein 7B
• NCBI Official Synonym Full Names: actin like 7B
• NCBI Official Symbol: ACTL7B
• NCBI Official Synonym Symbols: Tact1
• NCBI Protein Information: actin-like protein 7B
• UniProt Protein Name: Actin-like protein 7B
• Protein Family: Actin-like protein
• UniProt Gene Name: ACTL7B

NCBI Description

The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7B), and related gene, ACTL7A, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known. [provided by RefSeq, Jul 2008]