Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-ACTA1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart Muscle TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit ACTA1 Polyclonal Antibody | anti-ACTA1 antibody

ACTA1 antibody - C-terminal region

Gene Names
ACTA1; ACTA; ASMA; CFTD; MPFD; NEM1; NEM2; NEM3; SHPM; CFTD1; CFTDM
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACTA1; Polyclonal Antibody; ACTA1 antibody - C-terminal region; anti-ACTA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: STMKIKIIAPPERKYSVWIGGSILASLSTFQQMWITKQEYDEAGPSIVHR
Sequence Length
377
Applicable Applications for anti-ACTA1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-ACTA1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart Muscle TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-ACTA1 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Heart Muscle TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:100Other Working Concentrations: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Western Blot (WB)

(WB Suggested Anti-ACTA1 AntibodyPositive Control: Lane 1: 50ug term baboon muscle homogenatePrimary Antibody Dilution : 1:1666Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:1200Submitted by: Cynthia Blanco, University of Texas Health Science Center )

Western Blot (WB) (WB Suggested Anti-ACTA1 AntibodyPositive Control: Lane 1: 50ug term baboon muscle homogenatePrimary Antibody Dilution : 1:1666Secondary Antibody : Anti-rabbit-HRPSecondry Antibody Dilution : 1:1200Submitted by: Cynthia Blanco, University of Texas Health Science Center )

Western Blot (WB)

(WB Suggested Anti-ACTA1 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)

Western Blot (WB) (WB Suggested Anti-ACTA1 AntibodyTitration: 1.0 ug/mlPositive Control: A549 Whole Cell)
Related Product Information for anti-ACTA1 antibody
This is a rabbit polyclonal antibody against ACTA1. It was validated on Western Blot

Target Description: The product encoded by this gene belongs to the actin family of proteins, which are highly conserved proteins that play a role in cell motility, structure and integrity. Alpha, beta and gamma actin isoforms have been identified, with alpha actins being a major constituent of the contractile apparatus, while beta and gamma actins are involved in the regulation of cell motility. This actin is an alpha actin that is found in skeletal muscle. Mutations in this gene cause nemaline myopathy type 3, congenital myopathy with excess of thin myofilaments, congenital myopathy with cores, and congenital myopathy with fiber-type disproportion, diseases that lead to muscle fiber defects.
Product Categories/Family for anti-ACTA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
58
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
actin, alpha skeletal muscle
NCBI Official Synonym Full Names
actin alpha 1, skeletal muscle
NCBI Official Symbol
ACTA1
NCBI Official Synonym Symbols
ACTA; ASMA; CFTD; MPFD; NEM1; NEM2; NEM3; SHPM; CFTD1; CFTDM
NCBI Protein Information
actin, alpha skeletal muscle
UniProt Protein Name
Actin, alpha skeletal muscle
UniProt Gene Name
ACTA1
UniProt Synonym Gene Names
ACTA
UniProt Entry Name
ACTS_HUMAN

NCBI Description

The product encoded by this gene belongs to the actin family of proteins, which are highly conserved proteins that play a role in cell motility, structure and integrity. Alpha, beta and gamma actin isoforms have been identified, with alpha actins being a major constituent of the contractile apparatus, while beta and gamma actins are involved in the regulation of cell motility. This actin is an alpha actin that is found in skeletal muscle. Mutations in this gene cause nemaline myopathy type 3, congenital myopathy with excess of thin myofilaments, congenital myopathy with cores, and congenital myopathy with fiber-type disproportion, diseases that lead to muscle fiber defects. [provided by RefSeq, Jul 2008]

Uniprot Description

ACTA1: Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Polymerization of globular actin (G-actin) leads to a structural filament (F-actin) in the form of a two-stranded helix. Each actin can bind to 4 others. Interacts with TTID. Interacts (via its C-terminus) with USP25; the interaction occurs for all USP25 isoforms but is strongest for isoform USP25m in muscle differentiating cells. Belongs to the actin family.

Protein type: Cell development/differentiation; Motility/polarity/chemotaxis; Contractile; Cytoskeletal

Chromosomal Location of Human Ortholog: 1q42.13

Cellular Component: extracellular space; sarcomere; stress fiber; actin filament; cytosol; striated muscle thin filament; actin cytoskeleton

Molecular Function: protein binding; myosin binding; structural constituent of cytoskeleton; ADP binding; ATP binding

Biological Process: skeletal muscle fiber adaptation; muscle contraction; muscle thin filament assembly; response to steroid hormone stimulus; response to mechanical stimulus; response to lithium ion; response to extracellular stimulus; skeletal muscle fiber development; cell growth; muscle filament sliding

Disease: Nemaline Myopathy 3; Myopathy, Congenital, With Fiber-type Disproportion

Research Articles on ACTA1

Similar Products

Product Notes

The ACTA1 acta1 (Catalog #AAA3215030) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACTA1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ACTA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACTA1 acta1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: STMKIKIIAP PERKYSVWIG GSILASLSTF QQMWITKQEY DEAGPSIVHR. It is sometimes possible for the material contained within the vial of "ACTA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.