Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ACSM2BSample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ACSM2B Polyclonal Antibody | anti-ACSM2B antibody

ACSM2B Antibody - C-terminal region

Gene Names
ACSM2B; HXMA; ACSM2; HYST1046
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ACSM2B; Polyclonal Antibody; ACSM2B Antibody - C-terminal region; anti-ACSM2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELQQHVKSVTAPYKYPRKIEFVLNLPKTVTGKIQRTKLRDKEWKMSGKAR
Sequence Length
577
Applicable Applications for anti-ACSM2B antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ACSM2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ACSM2BSample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ACSM2BSample Tissue: Human Lung Tumor lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-ACSM2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63 kDa
NCBI Official Full Name
acyl-coenzyme A synthetase ACSM2B, mitochondrial
NCBI Official Synonym Full Names
acyl-CoA synthetase medium chain family member 2B
NCBI Official Symbol
ACSM2B
NCBI Official Synonym Symbols
HXMA; ACSM2; HYST1046
NCBI Protein Information
acyl-coenzyme A synthetase ACSM2B, mitochondrial
UniProt Protein Name
Acyl-coenzyme A synthetase ACSM2B, mitochondrial
UniProt Gene Name
ACSM2B
UniProt Synonym Gene Names
ACSM2; HYST1046
UniProt Entry Name
ACS2B_HUMAN

Uniprot Description

ACSM2B: Has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). Acts on acids from C(4) to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4- unsaturated acids (in vitro). Belongs to the ATP-dependent AMP-binding enzyme family.

Protein type: Ligase; Mitochondrial; EC 6.2.1.2

Chromosomal Location of Human Ortholog: 16p12.3

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: butyrate-CoA ligase activity; metal ion binding; ATP binding

Biological Process: xenobiotic metabolic process; fatty acid metabolic process

Research Articles on ACSM2B

Similar Products

Product Notes

The ACSM2B acsm2b (Catalog #AAA3221336) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACSM2B Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ACSM2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ACSM2B acsm2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELQQHVKSVT APYKYPRKIE FVLNLPKTVT GKIQRTKLRD KEWKMSGKAR. It is sometimes possible for the material contained within the vial of "ACSM2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.