Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Lymphocyte antigen 96 Recombinant Protein | Ly96 recombinant protein

Recombinant Mouse Lymphocyte antigen 96

Gene Names
Ly96; MD2; MD-2; ESOP-1
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Lymphocyte antigen 96; Recombinant Mouse Lymphocyte antigen 96; Ly-96; ESOP-1; Protein MD-2; Ly96 recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
19-160aa; Full Length
Sequence
EKQQWFCNSSDAIISYSYCDHLKFPISISSEPCIRLRGTNGFVHVEFIPRGNLKYLYFNLFISVNSIELPKRKEVLCHGHDDDYSFCRALKGETVNTSIPFSFEGILFPKGHYRCVAEAIAGDTEEKLFCLNFTIIHRRDVN
Sequence Length
142
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for Ly96 recombinant protein
Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both MD2 and TLR4, but not TLR4 alone, respond to LPS
Product Categories/Family for Ly96 recombinant protein
References
"ESOP-1, a secreted protein expressed in the hematopoietic, nervous, and reproductive systems of embryonic and adult mice." Kato K., Morrison A.M., Nakano T., Tashiro K., Honjo T. Blood 96:362-364(2000)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20.9 kDa
NCBI Official Full Name
lymphocyte antigen 96 isoform B
NCBI Official Synonym Full Names
lymphocyte antigen 96
NCBI Official Symbol
Ly96
NCBI Official Synonym Symbols
MD2; MD-2; ESOP-1
NCBI Protein Information
lymphocyte antigen 96
UniProt Protein Name
Lymphocyte antigen 96
Protein Family
UniProt Gene Name
Ly96
UniProt Synonym Gene Names
Esop1; Md2; Ly-96
UniProt Entry Name
LY96_MOUSE

Uniprot Description

LY96: a secreted protein that binds to the extracellular domains of TLR2 and TLR4. Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. Enhances TLR4-dependent activation of NF-kappa-B. Cells expressing both LY96 and TLR4, but not TLR4 alone, respond to LPS. Heterogeneous homopolymer formed from homodimers; disulfide-linked. Belongs to the lipopolysaccharide (LPS) receptor complex, a multi-protein complex containing at least CD14, LY96 and TLR4. Ligand binding induces interaction with TLR4 and oligomerization of the complex.

Protein type: Secreted; Secreted, signal peptide

Cellular Component: extracellular region; intrinsic to plasma membrane; lipopolysaccharide receptor complex

Molecular Function: lipopolysaccharide receptor activity; protein binding

Biological Process: detection of lipopolysaccharide; immune system process; inflammatory response; innate immune response; lipopolysaccharide-mediated signaling pathway; positive regulation of lipopolysaccharide-mediated signaling pathway; positive regulation of tumor necrosis factor production; response to lipopolysaccharide; toll-like receptor 4 signaling pathway

Research Articles on Ly96

Similar Products

Product Notes

The Ly96 ly96 (Catalog #AAA1375411) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 19-160aa; Full Length. The amino acid sequence is listed below: EKQQWFCNSS DAIISYSYCD HLKFPISISS EPCIRLRGTN GFVHVEFIPR GNLKYLYFNL FISVNSIELP KRKEVLCHGH DDDYSFCRAL KGETVNTSIP FSFEGILFPK GHYRCVAEAI AGDTEEKLFC LNFTIIHRRD VN. It is sometimes possible for the material contained within the vial of "Lymphocyte antigen 96, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.